Molecule Information

General Information of the Molecule (ID: Mol01102)

• Name: Tetracycline efflux protein (TET41) ,Serratia marcescens
• Synonyms: TET41
• Molecule Type: Protein
• Gene Name: TET41
• Sequence:
  MKKPMLVILLTVLLDAVGIGLIMPILPALLRSLGGLDAGSLHYGALLAAYALMQFLFSPI
  LGALSDRFGRRPVLLISLAGAAADYLLMAFAPTLAWLYLGRLLAGITGANMAVATAYVTD
  ITPAGQRARRFGLVGAVFGVGFIVGPLLGGSLGEWHLHAPFLAASAMNAVNLAMAFFLLP
  ESRKPRARAAEKIRLNPFSSLRRLHGKPGLLPLAGIYLIMALVSQAPATLWILYGQDRFG
  WSMMVAGLSLAGYGACHALSQAFAIGPLVARLGERKALLIGLAADAMGLALLSIATRGWA
  PFALLPFFAAGGMALPALQALMAQKVDDDHQGELQGTLASMGSLIGVAGPLVATALYAAT
  RDVWPGLVWALAAALYLLVPLLLARSRERDAA
• Function: Resistance to tetracycline by an active tetracycline efflux. This is an energy-dependent process that decreases the accumulation of the antibiotic in whole cells. This protein functions as a metal-tetracycline/H(+) antiporter.
• Uniprot ID: A0A7S6YKU5_SERMA

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Nocardiaceae
Genus: Nocardia
Species: Nocardia otitidiscaviarum

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Serratia marcescens infection [1]

• Resistant Disease: Serratia marcescens infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli JM109; 562
• Experiment for Molecule Alteration: DNA sequencing and protein and phylogenetic assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet 41 is a tetracycline-specific efflux pump, which lead to drug resistance.

References

• Ref 1: Novel tetracycline resistance determinant isolated from an environmental strain of Serratia marcescens. Appl Environ Microbiol. 2007 Apr;73(7):2199-206. doi: 10.1128/AEM.02511-06. Epub 2007 Feb 16.