Molecule Information
General Information of the Molecule (ID: Mol01100)
| Name |
Tetracycline efflux MFS transporter Tet(38) (TET38)
,Staphylococcus aureus
|
||||
|---|---|---|---|---|---|
| Synonyms |
tet38; tet(38); DQV20_03865; G6X35_03865; G6Y24_14280; HK402_00520; 38; Tetracycline resistant protein Tet38
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
tet38
|
||||
| Sequence |
MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH FGIILIILGLMSIVGLVLFVILNRWTQSEK Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Staphylococcus aureus infection | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Tetracycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
| Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
| Mechanism Description | MgrA was an indirect regulator of tet38 expression. The mgrA tet38 double mutant became more susceptible to tetracycline than the wild-type parent strain. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
