Molecule Information
General Information of the Molecule (ID: Mol01098)
Name |
Tartronate semialdehyde reductase (TSAR)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
Tartronate semialdehyde reductase; TSAR; yhaE; b3125; JW5526
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
garR
|
||||
Gene ID | |||||
Sequence |
MKVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAETASTAKAIAEQCDVI
ITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPV SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALN IAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDL ANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEVTR Click to Show/Hide
|
||||
Function |
Catalyzes the reduction of tatronate semialdehyde to D-glycerate.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Triclosan | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | E. coli IFN4 | 562 | ||
Experiment for Molecule Alteration |
Microarray hybridization assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | A FabI NAD+ triclosan ternary complex is formed by face-to-face interaction between the phenol ring of triclosan and the nicotinamide ring of NAD+ in the active site of FabI (enoyl-acyl carrier protein reductase) and therefore highly expressed reductases (narGHJI, garR, hcp and yeaA) and dehydrogenases (fdnGHI, ykgEF, garD, gldA and yeiQ) could bind triclosan which were as the NAD(P) cofactor, thus lowering the effective triclosan concentration. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.