Molecule Information
General Information of the Molecule (ID: Mol01097)
| Name |
Streptothricin N-acetyltransferase Sat4 (SAT4)
,Campylobacter coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
dhps; EC 2.5.1.15; Fragment
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
sat4
|
||||
| Sequence |
MITEMKAGHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEAPYLKSYQDEEDEEDEE
ADCLEYIDNTDKIIYLYYQDDKCVGKVKLRKNWNRYAYIEDIAVCKDFRGQGIGSALINI SIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDTMLYANFENNFEKAVFWYLRF FVIISFLGYL Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Campylobacter fetus infection [ICD-11: 1C40.0] | [1] | |||
| Resistant Disease | Campylobacter fetus infection [ICD-11: 1C40.0] | |||
| Resistant Drug | Streptothricin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Campylobacter coli strain BE/G4 | 195 | ||
| Campylobacter coli strain BE5698 | 195 | |||
| Campylobacter coli strain BE6361 | 195 | |||
| Campylobacter coli strain BM2509 | 195 | |||
| Campylobacter coli strain Ck196 | 195 | |||
| Campylobacter coli strain Ck197 | 195 | |||
| Campylobacter coli strain Ck199 | 195 | |||
| Campylobacter coli strain Ck204 | 195 | |||
| Campylobacter jejuni strain Ck194 | 197 | |||
| Escherichia coli strain SURE | 562 | |||
| Escherichia coli strain SURE (pAT132) | 562 | |||
| Experiment for Molecule Alteration |
SDS-polyacrylamide gel assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | The sat 4 streptothricin resistance gene from Campylobacter coli BE/G4 was cloned into pUC18, and its nucleotide sequence was determined. Streptothricin acetyltransferase activity was detected in Escherichia coli cells containing recombinant plasmid pAT132 which carries the sat4 gene as an insert. The deduced amino acid sequence displayed 21-27% amino acid identity with streptothricin acetyltransferases from Escherichia coli and streptothricin producers Streptomyces lavendulae and Streptomyces noursei. The sat 4 gene was detected by hybridization in clinical and environmental isolates of Campylobacter spp. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
