Molecule Information

General Information of the Molecule (ID: Mol01096)

• Name: Streptothricin acetyltransferase (STA) ,Streptomyces lavendulae
• Synonyms: STAT
• Molecule Type: Protein
• Gene Name: sta
• Sequence:
  MTTTHGSTYEFRSARPGDAEAIEGLDGSFTTSTVFEVDVTGDGFALREVPADPPLVKVFP
  DDGGSDGEDGAEGEDADSRTFVAVGADGDLAGFAAVSYSAWNQRLTIEDIEVAPGHRGKG
  IGRVLMRHAADFARERGAGHLWLEVTNVNAPAIHAYRRMGFAFCGLDSALYQGTASEGEH
  ALYMSMPCP
• Function: Involved in resistance to streptothricin, a broad-spectrum antibiotic produced by streptomycetes. Detoxifies streptothricin via acetylation of the beta amino group of the first beta-lysyl moiety of streptothricin.
• Uniprot ID: STA_STRLA

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces lavendulae

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Streptothricin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces lavendulae infection [1]

• Resistant Disease: Streptomyces lavendulae infection [ICD-11: 1C43.13]
• Resistant Drug: Streptothricin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces lividans strain Tk21; 1916
• In Vitro Model: Bacillus subtilis strain RM141; 1423
• In Vitro Model: Escherichia coli strain 5131-5; 562
• Experiment for Molecule Alteration: [a-32P] dCTP by the dideoxynucleoside triphosphate chain termination method assay
• Mechanism Description: The nucleotide sequence of the streptothricin acetyltransferase (STAT) gene from streptothricin-producing Streptomyces lavendulae predicts a 189-amino-acid protein of molecular weight 20,000, which is consistent with that determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis of the purified enzyme. By addition of promoter signals and a synthetic ribosome-binding (Shine-Dalgarno) sequence at an appropriate position upstream of the STAT translational start codon, the STAT gene confers streptothricin resistance on Escherichia coli and Bacillus subtilis.

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Streptothricin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces lividans strain Tk21; 1916
• In Vitro Model: Bacillus subtilis strain RM141; 1423
• In Vitro Model: Escherichia coli strain 5131-5; 562
• Experiment for Molecule Alteration: [a-32P] dCTP by the dideoxynucleoside triphosphate chain termination method assay
• Mechanism Description: The nucleotide sequence of the streptothricin acetyltransferase (STAT) gene from streptothricin-producing Streptomyces lavendulae predicts a 189-amino-acid protein of molecular weight 20,000, which is consistent with that determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis of the purified enzyme. By addition of promoter signals and a synthetic ribosome-binding (Shine-Dalgarno) sequence at an appropriate position upstream of the STAT translational start codon, the STAT gene confers streptothricin resistance on Escherichia coli and Bacillus subtilis.

Disease Class: Bacillus subtilis infection [1]

• Resistant Disease: Bacillus subtilis infection [ICD-11: 1G40.1]
• Resistant Drug: Streptothricin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces lividans strain Tk21; 1916
• In Vitro Model: Bacillus subtilis strain RM141; 1423
• In Vitro Model: Escherichia coli strain 5131-5; 562
• Experiment for Molecule Alteration: [a-32P] dCTP by the dideoxynucleoside triphosphate chain termination method assay
• Mechanism Description: The nucleotide sequence of the streptothricin acetyltransferase (STAT) gene from streptothricin-producing Streptomyces lavendulae predicts a 189-amino-acid protein of molecular weight 20,000, which is consistent with that determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis of the purified enzyme. By addition of promoter signals and a synthetic ribosome-binding (Shine-Dalgarno) sequence at an appropriate position upstream of the STAT translational start codon, the STAT gene confers streptothricin resistance on Escherichia coli and Bacillus subtilis.

References

• Ref 1: Nucleotide sequence of the streptothricin acetyltransferase gene from Streptomyces lavendulae and its expression in heterologous hosts. J Bacteriol. 1987 May;169(5):1929-37. doi: 10.1128/jb.169.5.1929-1937.1987.