Molecule Information

General Information of the Molecule (ID: Mol01093)

• Name: Streptomycin aminoglycoside adenylyltransferase ant(6)-Ib (SA6IB) ,Campylobacter fetus subsp. Fetus
• Synonyms: ant(6)-Ib; 6)-Ib
• Molecule Type: Protein
• Gene Name: ant(6)-Ib
• Sequence:
  MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINS
  DEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKL
  VKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAID
  HLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMW
  KSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQR
• Uniprot ID: D8L9Z0_CAMFE

Kingdom: N.A.
Phylum: Proteobacteria
Class: Epsilonproteobacteria
Order: Campylobacterales
Family: Campylobacteraceae
Genus: Campylobacter
Species: Campylobacter fetus subsp. fetus

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli S17-1 Lambdapir; 1227813
• Experiment for Molecule Alteration: Illumina/Solexa sequencing assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The 286-amino-acid streptomycin resistance determinant, ANT(6)-Ib, belongs to a family of aminoglycoside nucleotidyltransferases. The resistance phenotypes were demonstrated by gene inactivation and expression.

References

• Ref 1: Two novel antibiotic resistance genes, tet(44) and ant(6)-Ib, are located within a transferable pathogenicity island in Campylobacter fetus subsp. fetus. Antimicrob Agents Chemother. 2010 Jul;54(7):3052-5. doi: 10.1128/AAC.00304-10. Epub 2010 May 17.