General Information of the Molecule (ID: Mol01091)
Name
Streptomycin 3''-adenylyltransferase (AADA27) ,Acinetobacter lwoffii
Synonyms
aadA27; Streptomycin 3''-adenylyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aadA27
Sequence
MSETLQLEQLTESLQQLLGESLFAIYLYGSAVDGGLGPESDLDVLVVVNQALTLHQRQQL
AETLLKISYPIGAAQRALEVTIVLKEQILSGSYPLSYELQFGEWLREELNQGALLRAHTD
PDLSILLKKAQMHHRSLLGPSLTQWSTAIPEQHLWQAMADTYPSIVAHWDEDADERNQIL
ALCRIYFSLITNEIVPKDQAAHWVIAQLPSLHQPILQRMIQEYKGEIRKQNWQQQHQALG
PVVDFLSSKIDEQFNKKSSLIK
    Click to Show/Hide
Uniprot ID
A0A1C7ZQH8_ACILW
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter lwoffii
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Spectinomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Spectinomycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter lwoffii VS15 28090
Escherichia coli JM109 562
Pseudomonas sp. Tik3 761262
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Streptomycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter lwoffii VS15 28090
Escherichia coli JM109 562
Pseudomonas sp. Tik3 761262
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli.
References
Ref 1 The ancient small mobilizable plasmid pALWED1.8 harboring a new variant of the non-cassette streptomycin/spectinomycin resistance gene aadA27. Plasmid. 2016 Mar-May;84-85:36-43. doi: 10.1016/j.plasmid.2016.02.005. Epub 2016 Feb 16.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.