Molecule Information
General Information of the Molecule (ID: Mol01091)
Name |
Streptomycin 3''-adenylyltransferase (AADA27)
,Acinetobacter lwoffii
|
||||
---|---|---|---|---|---|
Synonyms |
aadA27; Streptomycin 3''-adenylyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aadA27
|
||||
Sequence |
MSETLQLEQLTESLQQLLGESLFAIYLYGSAVDGGLGPESDLDVLVVVNQALTLHQRQQL
AETLLKISYPIGAAQRALEVTIVLKEQILSGSYPLSYELQFGEWLREELNQGALLRAHTD PDLSILLKKAQMHHRSLLGPSLTQWSTAIPEQHLWQAMADTYPSIVAHWDEDADERNQIL ALCRIYFSLITNEIVPKDQAAHWVIAQLPSLHQPILQRMIQEYKGEIRKQNWQQQHQALG PVVDFLSSKIDEQFNKKSSLIK Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter lwoffii VS15 | 28090 | ||
Escherichia coli JM109 | 562 | |||
Pseudomonas sp. Tik3 | 761262 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter lwoffii VS15 | 28090 | ||
Escherichia coli JM109 | 562 | |||
Pseudomonas sp. Tik3 | 761262 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.