Molecule Information

General Information of the Molecule (ID: Mol01086)

• Name: Spectinomycin 9-O-adenylyltransferase (ANT9) ,Staphylococcus aureus
• Synonyms: ant9; spd; SAMEA70245418_02659; EC 2.7.7.47; Spectinomycin adenyltransferase
• Molecule Type: Protein
• Gene Name: ant9
• Sequence:
  MEEPNKQIDNVLIELKRLFSKDLLGVYLYGSYVKGGLKKDSDVDFLVIINRDMTKEEKRI
  LISKIMPISKEIGEDTSLKYIELTVLNYHENENWSYPPIEEFIYGEWLREDYLNYFIPEK
  NNNIDLTILLYQAKLSSISIYGENNINNLIPDVPFIDLQKAIKESSKELIKDFYGDETNV
  ILTLCRMIVTYETGKFYSKDLAGSMIIENLSENLSIEENNLISLAISSYKNGNSVDWELF
  PVKSVIKKLYAYLNYKL
• Uniprot ID: W1JB67_STAAU

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Spectinomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Staphylococcus aureus ST398; 523796
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: Downstream of the repN sequence was located a novel spectinomycin adenyltransferase gene, which was designated spd. The gene encoded a novel 257 amino acid protein, named Spd, which shared 47% identity with the spectinomycin adenyltransferase Aad9 from Enterococcus faecalis.

References

• Ref 1: Identification of a novel plasmid-associated spectinomycin adenyltransferase gene spd in methicillin-resistant Staphylococcus aureus ST398 isolated from animal and human sources. J Antimicrob Chemother. 2014 May;69(5):1193-6. doi: 10.1093/jac/dkt510. Epub 2014 Jan 8.