Molecule Information
General Information of the Molecule (ID: Mol01079)
Name |
rRNA methyltransferase PikR2 (PIKR2)
,Streptomyces venezuelae
|
||||
---|---|---|---|---|---|
Synonyms |
pikR2; rRNA methyltransferase PikR2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
pikR2
|
||||
Sequence |
MAFSPQGGRHELGQNFLVDRSVIDEIDGLVARTKGPILEIGPGDGALTLPLSRHGRPITA
VELDGRRAQRLGARTPGHVTVVHHDFLQYPLPRNPHVVVGNVPFHLTTAIMRRLLDAQHW HTAVLLVQWEVARRRAGVGGSTLLTAGWAPWYEFDLHSRVPARAFRPMPGVDGGVLAIRR RSAPLVGQVKTYQDFVRQVFTGKGNGLKEILRRTGRISQRDLATWLRRNEISPHALPKDL KPGQWASLWELTGGTADGSFDGTAGGGAAGSHGAARVGAGHPGGRVSASRRGVPQARRGR GHAVRSSTGTEPRWGRGRAESA Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli | 668369 | ||
Escherichia coli BL21(DE3) | 469008 | |||
Escherichia coli BL21(DE3)pLysS | 866768 | |||
Escherichia coli S17-1 | 1227813 | |||
Streptomyces antibioticus ATCC 11891 | 1890 | |||
Streptomyces venezuelae ATCC 15439 | 54571 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism. |
Clinical Trial Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Thiostrepton | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli | 668369 | ||
Escherichia coli BL21(DE3) | 469008 | |||
Escherichia coli BL21(DE3)pLysS | 866768 | |||
Escherichia coli S17-1 | 1227813 | |||
Streptomyces antibioticus ATCC 11891 | 1890 | |||
Streptomyces venezuelae ATCC 15439 | 54571 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Apramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli | 668369 | ||
Escherichia coli BL21(DE3) | 469008 | |||
Escherichia coli BL21(DE3)pLysS | 866768 | |||
Escherichia coli S17-1 | 1227813 | |||
Streptomyces antibioticus ATCC 11891 | 1890 | |||
Streptomyces venezuelae ATCC 15439 | 54571 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.