Molecule Information
General Information of the Molecule (ID: Mol01074)
| Name |
rRNA adenine N-6-methyltransferase ermC' (ERMC)
,Bacillus subtilis
|
||||
|---|---|---|---|---|---|
| Synonyms |
Erythromycin resistance protein; Macrolide-lincosamide-streptogramin B resistance protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ermC'
|
||||
| Sequence |
MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVFDSIA DEIYLIVEYGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK SRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYK LFNK Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
This protein produces a dimethylation of the adenine residue at position 2085 in 23S rRNA, resulting in reduced affinity between ribosomes and macrolide-lincosamide-streptogramin B antibiotics.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2], [3] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Bacillus subtilis strain BD170 | 1423 | ||
| Bacillus subtilis strain BD430 | 1423 | |||
| Bacillus subtilis strain BD431 | 1423 | |||
| Bacillus subtilis strain BD488 | 1423 | |||
| Bacillus subtilis strain BD81 | 1423 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Mechanism Description | The ermC gene of plasmid pE194 specifies resistance to the macrolidelincosamide-streptogramin B antibiotics. pE194 specifies an RNA methylase that can utilize either 50 S ribosomes or 23 S rRNA as substrates,with a specific dimethylation of adenine in 23 S rRNA. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2], [3] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Macrolides | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Bacillus subtilis strain BD170 | 1423 | ||
| Bacillus subtilis strain BD430 | 1423 | |||
| Bacillus subtilis strain BD431 | 1423 | |||
| Bacillus subtilis strain BD488 | 1423 | |||
| Bacillus subtilis strain BD81 | 1423 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Mechanism Description | The ermC gene of plasmid pE194 specifies resistance to the macrolidelincosamide-streptogramin B antibiotics. pE194 specifies an RNA methylase that can utilize either 50 S ribosomes or 23 S rRNA as substrates,with a specific dimethylation of adenine in 23 S rRNA. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
