Molecule Information

General Information of the Molecule (ID: Mol01072)

Name	Rifampin monooxygenase (IRI) ,Rhodococcus equi
Synonyms	iri; Rifampin monooxygenase Click to Show/Hide
Molecule Type	Protein
Gene Name	iri
Sequence	MSDVIIVGAGPTGLMLAGELRLQGVDVVVVDKDEEPTQFVRALGIHVRSIEIMEQRGLLD KFLAHGRKYPLGGFFAGISKPAPAHLDTAHGYVLGIPQPEIDRILAEHATEVGADIQRGK RVVAIRQDTDNVAAELSDGTTLHARYLVGCDGGRSTVRKLRSTSVFPASRTSADTLIGEM DVTMPADELAAVVAEIRETHKRFGVGPAGNGAFRVVVPAAEVADGRATPTTLDDIKQQLL AIAGTDFGVHSPRWLSRFGDATRLADDYRRDRVFLAGDAAHIHPPMGGQGLNLGVQDAFN LGWKLAAEINGWAPVGLLDTYESERRPVAADVLDNTRAQAELISTAAGPQAVRRLISELM EFEDVKRYLTEKITAISIRYDFGEGDDLLGRRLRNIALTRGNLYDLMRSGRGLLLDQGGQ LSVDGWSDRADHIVDTSTELEAPAVLLRPDGHVAWIGDAQAELDTQLSTWFGRSARDRA Click to Show/Hide
Uniprot ID	P95598_RHOHA
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Nocardiaceae Genus: Rhodococcus Species: Rhodococcus equi

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Rifampin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Rhodococcus equi infection [ICD-11: 1A00-1C4Z]			[1]
Resistant Disease	Rhodococcus equi infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Rifampin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli strain MM294		562
	Rhodococcus equi strain ATCC 14887		43767
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Monitored by zones of inhibition assay
Mechanism Description	The original 8-kb clone and all subclones with the intact iri gene conferred similar 25-fold increases in rifampin resistance in rhodococcal strain Ri8. Clones growing on rifampin-containing selective plates all possessed an insert of about 8 kb, and retransformation into strain Ri8 demonstrated that this segment of DNA increased the rifampin MIC about 25-fold and conferred the ability to inactivate the antibiotic: rifampin at a concentration of 20 mg/ml was completely inactivated in about 6 h (as monitored by zones of inhibition on plates spread with a tester strain). inactivation gene cloned from the R.equi type strain, ATCC 14887, can confer a 10-fold increase in resistance to rifampin in E.coli as well as a 25-fold increase in Rhodococcus.

References

Ref 1	Monooxygenase-like sequence of a Rhodococcus equi gene conferring increased resistance to rifampin by inactivating this antibiotic. Antimicrob Agents Chemother. 1997 Jan;41(1):218-21. doi: 10.1128/AAC.41.1.218.