Molecule Information
      General Information of the Molecule (ID: Mol01072)
  
  | Name | Rifampin monooxygenase (IRI)
                                ,Rhodococcus equi
                               | ||||
|---|---|---|---|---|---|
| Synonyms | iri; Rifampin monooxygenase     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | iri | ||||
| Sequence | MSDVIIVGAGPTGLMLAGELRLQGVDVVVVDKDEEPTQFVRALGIHVRSIEIMEQRGLLD KFLAHGRKYPLGGFFAGISKPAPAHLDTAHGYVLGIPQPEIDRILAEHATEVGADIQRGK RVVAIRQDTDNVAAELSDGTTLHARYLVGCDGGRSTVRKLRSTSVFPASRTSADTLIGEM DVTMPADELAAVVAEIRETHKRFGVGPAGNGAFRVVVPAAEVADGRATPTTLDDIKQQLL AIAGTDFGVHSPRWLSRFGDATRLADDYRRDRVFLAGDAAHIHPPMGGQGLNLGVQDAFN LGWKLAAEINGWAPVGLLDTYESERRPVAADVLDNTRAQAELISTAAGPQAVRRLISELM EFEDVKRYLTEKITAISIRYDFGEGDDLLGRRLRNIALTRGNLYDLMRSGRGLLLDQGGQ LSVDGWSDRADHIVDTSTELEAPAVLLRPDGHVAWIGDAQAELDTQLSTWFGRSARDRA     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Rhodococcus equi infection | [1] | |||
| Resistant Disease | Rhodococcus equi infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli strain MM294 | 562 | ||
| Rhodococcus equi strain ATCC 14887 | 43767 | |||
| Experiment for Molecule Alteration | DNA sequencing assay | |||
| Experiment for Drug Resistance | Monitored by zones of inhibition assay | |||
| Mechanism Description | The original 8-kb clone and all subclones with the intact iri gene conferred similar 25-fold increases in rifampin resistance in rhodococcal strain Ri8. Clones growing on rifampin-containing selective plates all possessed an insert of about 8 kb, and retransformation into strain Ri8 demonstrated that this segment of DNA increased the rifampin MIC about 25-fold and conferred the ability to inactivate the antibiotic: rifampin at a concentration of 20 mg/ml was completely inactivated in about 6 h (as monitored by zones of inhibition on plates spread with a tester strain). inactivation gene cloned from the R.equi type strain, ATCC 14887, can confer a 10-fold increase in resistance to rifampin in E.coli as well as a 25-fold increase in Rhodococcus. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
