Molecule Information
      General Information of the Molecule (ID: Mol01069)
  
  | Name | Ribosomal RNA large subunit methyltransferase Cfr (CFRB)
                                ,Enterococcus faecium
                               | ||||
|---|---|---|---|---|---|
| Synonyms | 23S rRNA (adenine(2503)-C(8))-methyltransferase; 23S rRNA m8A2503 methyltransferase; cfr     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | cfr(B) | ||||
| Sequence | MQQKNKYIRIQEFLKQNKFPNYRMKQITNAIFPGRINNFNEITVLPKSLRDMLIEEFGES ILNIVPLKAQQSTQVSKVLFGISGDEKIETVNMKYKAGWESFCISSQCGCNFGCKFCATG DIGLKRNLTSDEITDQILYFHLQGHSIDSISFMGMGEALANVQVFDALNVLTDPALFALS PRRLSISTIGIIPNIKKLTQNYPQVNLTFSLHSPFNEQRSELMPINERYPLSDVMDTLDE HIRVTSRKVYIAYIMLHGVNDSIEHAKEVVNLLRGRYRSGNLYHVNIIRYNPTVSSRMRF EEANEKCLVNFYKKLKSAGIKVTIRSQFGIDIDAACGQLYGNYQKTNSQ     Click to Show/Hide | ||||
| Function | Specifically methylates position 8 of adenine 2503 in 23S rRNA. Confers resistance to some classes of antibiotics.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Clindamycin | |||
| Molecule Alteration | Missense mutation | c.2576G>T | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus ATCC 29213 | 1280 | ||
| Enterococcus faecium ATCC 29212 | 1352 | |||
| Enterococcus faecium ATCC 35667 | 1352 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | Cfr methylates the unreactive C2- and C8-carbon atoms on the A2503 residue located in a functionally critical region of the 23S rRNA component.The methylation at C8 protects the Cfr-producing bacteria from the action of five major classes of antibiotics, namely, phenicols, oxazolidinones, pleuromutilins, macrolides, and streptogramin A compounds (PhLOPSA phenotype). | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
