Molecule Information

General Information of the Molecule (ID: Mol01068)

Name	Ribonuclease PH (RPH) ,Listeria monocytogenes
Synonyms	RNase PH; tRNA nucleotidyltransferase; LMOf2365_1247 Click to Show/Hide
Molecule Type	Protein
Gene Name	rph
Sequence	MRVDGRESNALRNIEVTPDYLMHPEGSVLIASGNTKVICSASVETKVPPFMRGEGRGWIS AEYSMLPRATNTRNIRESSKGKVTGRTMEIQRLIGRALRAVVDLDALGERTIWLDCDVIQ ADGGTRTASITGAFIAMVMAIAKLDEAVPFAKFPVKDFLAATSVGVLEEGGTVLDLNYVE DSAAQVDMNIIMTGSGAFVELQGTGEEATFSETELAELIALGKKGISELIEIQKETLGDK VTARIKGE Click to Show/Hide
Function	Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates, but this may not be physiologically important. Probably plays a role in initiation of 16S rRNA degradation (leading to ribosome degradation) during starvation. Click to Show/Hide
Uniprot ID	RNPH_LISMF
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Listeriaceae Genus: Listeria Species: Listeria monocytogenes

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Rifampin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: HIV-infected patients with tuberculosis [ICD-11: 1C60.0]			[1], [2], [3]
Resistant Disease	HIV-infected patients with tuberculosis [ICD-11: 1C60.0]		Disease Info
Resistant Drug	Rifampin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Bacillus cereus RPH-Bc		1396
	Escherichia coli Rosetta(DE3) pLysS		866768
	L. monocytogenes		1639
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	MIC assay
Mechanism Description	RIF phosphotransferase (rph) led to the identification of a new resistance gene and associated enzyme responsible for inactivating rifamycin antibiotics by phosphorylation.

Rifaximin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: MycoBacterial infection [ICD-11: 1B2Z.1]			[1], [2], [3]
Resistant Disease	MycoBacterial infection [ICD-11: 1B2Z.1]		Disease Info
Resistant Drug	Rifaximin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Bacillus cereus RPH-Bc		1396
	Escherichia coli Rosetta(DE3) pLysS		866768
	L. monocytogenes		1639
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	MIC assay
Mechanism Description	RIF phosphotransferase (rph) led to the identification of a new resistance gene and associated enzyme responsible for inactivating rifamycin antibiotics by phosphorylation.

References

Ref 1	A rifamycin inactivating phosphotransferase family shared by environmental and pathogenic bacteria. Proc Natl Acad Sci U S A. 2014 May 13;111(19):7102-7. doi: 10.1073/pnas.1402358111. Epub 2014 Apr 28.
Ref 2	Rifampin phosphotransferase is an unusual antibiotic resistance kinase. Nat Commun. 2016 Apr 22;7:11343. doi: 10.1038/ncomms11343.
Ref 3	Phosphorylative inactivation of rifampicin by Nocardia otitidiscaviarum. J Antimicrob Chemother. 1994 Jun;33(6):1127-35. doi: 10.1093/jac/33.6.1127.