Molecule Information
General Information of the Molecule (ID: Mol01065)
Name |
Ras association domain-containing protein 8 (RASSF8)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
RASSF8; Fragment
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
RASSF8
|
||||
Sequence |
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
ISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSI KRREPKRKSLTFTGGAKGLMDIFGKGKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSI EKQLESNEIEIRFWEQKYNSNLEEEIVR Click to Show/Hide
|
||||
Uniprot ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Colorectal cancer | [1] | |||
Resistant Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
Resistant Drug | Methotrexate | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell colony | Activation | hsa05200 | ||
Cell invasion | Activation | hsa05200 | ||
Cell migration | Activation | hsa04670 | ||
Cell proliferation | Activation | hsa05200 | ||
Cell viability | Activation | hsa05200 | ||
In Vitro Model | SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 |
SW620 cells | Colon | Homo sapiens (Human) | CVCL_0547 | |
LS174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Colony-forming assay; Transwell assay; Wound healing assay; Flow cytometry assay | |||
Mechanism Description | miR-505 advanced MTX-induced LS174T cells migration and invasiveness as well as depressed LS174T/MTX cell apoptosis through the down-regulation of RASSF8. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.