Molecule Information
General Information of the Molecule (ID: Mol01064)
Name |
Quinolone resistance protein NorB (NORB)
,Staphylococcus aureus
|
||||
---|---|---|---|---|---|
Synonyms |
SAOUHSC_01448
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
norB
|
||||
Gene ID | |||||
Sequence |
MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL Click to Show/Hide
|
||||
Function |
Multidrug efflux pump that acts independently of NorA and is one of the factors that confers resistance against diverse quinolones and chemical compounds. Extrudes norfloxacin, ciprofloxacin, cetrimide, tetraphenylphosphonium ion (TPP), sparfloxacin, moxifloxacin and ethidium bromide. Contributes also to the efflux of tetracycline.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Moxifloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Norfloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Sparfloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Clinical Trial Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Cetrimide | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Investigative Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Homidium bromide | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Quinolones | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Experiment for Molecule Alteration |
DNA microarray hybridization assay | |||
Experiment for Drug Resistance |
Serial twofold agar dilutions assay | |||
Mechanism Description | MgrA was an indirect regulator of norB expression. The mgrA norB double mutant was reproducibly twofold more susceptible to the tested quinolones than the mgrA mutant. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.