General Information of the Molecule (ID: Mol01062)
Name
Quinolone efflux pump (QEPA2) ,Escherichia coli
Synonyms
qepA2; Quinolone efflux pump
    Click to Show/Hide
Molecule Type
Protein
Gene Name
qepA2
Sequence
MSATLHDTAADRRKATRREWIGLAVVALPCLVYAMDLTVLNLALPVLSRELQPSSAQLLW
ILDIYGFFVAGFLITMGTLGDRIGRRRLLLIGAAFFAFGSVLAALADTAALLIAARALLG
LAGATIAPSTMALIRNMFHDPRQRQFAIGVWIAAFSLGSAIGPLVGGVLLEFFHWGAVFW
LNVPVMLLTLALGPRFLPEYRDPDAGHLDLASVLLSLAAVLLTIYGLKQLAEHGAGLASM
AALLAGLAVGALFLRRQGHIAYPLLDLRLFAHAPFRAALAAYALAALAMFGVYIFMTQYL
QLVLGLSPLQAGLATLPWSLCFVIGSLLSPQLAARWPAARILVVGLSAAAFGFAVLGLGQ
GLWWLVPATIVMGLGLAPVFTIGNEIIITSAPSERAGAASALSETVSEFSGALGIALFGS
VGLVVYRQALTSAALPGLPADALQAAGASLGGAVHLADTLPAWQGAALLAAARAGFTDAL
QATAWAGAVLVLVAAGLVARLLRKRPALASG
    Click to Show/Hide
Uniprot ID
B5AG18_ECOLX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Missense mutation
p.A99G+p.V134I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
PCR amplification and sequence alignments assay
Experiment for
Drug Resistance
Disk diffusion assay
Mechanism Description QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.
Moxifloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Moxifloxacin
Molecule Alteration Missense mutation
p.A99G+p.V134I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
PCR amplification and sequence alignments assay
Experiment for
Drug Resistance
Disk diffusion assay
Mechanism Description QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Norfloxacin
Molecule Alteration Missense mutation
p.A99G+p.V134I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
PCR amplification and sequence alignments assay
Experiment for
Drug Resistance
Disk diffusion assay
Mechanism Description QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.
References
Ref 1 Plasmid-mediated quinolone resistance pump QepA2 in an Escherichia coli isolate from France. Antimicrob Agents Chemother. 2008 Oct;52(10):3801-4. doi: 10.1128/AAC.00638-08. Epub 2008 Jul 21.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.