Molecule Information
General Information of the Molecule (ID: Mol01061)
Name |
Pyruvate dehydrogenase E1 component subunit alpha (PDHA1)
,Mus musculus
|
||||
---|---|---|---|---|---|
Synonyms |
PDHE1-A type I; Pdha-1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
Pdha1
|
||||
Gene ID | |||||
Location |
chr X: 158905205-158921409[-]
|
||||
Sequence |
MRKMLAAVSRVLAGSAQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA HGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST DYYKRGDFIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP LEELGYHIYSSDPPFEVRGANQWIKFKSVS Click to Show/Hide
|
||||
Function |
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Colorectal cancer | [1] | |||
Resistant Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
Resistant Drug | Cetuximab | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
Cell Pathway Regulation | Pentose phosphate signaling pathway | Activation | hsa00030 | |
In Vitro Model | SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 |
GEO cells | Colon | Homo sapiens (Human) | CVCL_0271 | |
In Vivo Model | Xenografts mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
2D DIGE assay | |||
Mechanism Description | LDHB and PDHA1 were downregulated in GEO-CR tumor xenografts, similarly to the corresponding deregulations observed in the derived cell lines. Upregulation of G6PDH and transketolase (TkT) was also actually maintained in tumor xenografts. Indeed, PPP2CA expression in xenografted samples was similarly evaluated, demonstrating that protein downregulation in vivo was even more pronounced than that measured in GEO-CR cells. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.