Molecule Information
General Information of the Molecule (ID: Mol01057)
Name |
Protein TetT (TETT)
,Streptococcus pyogenes
|
||||
---|---|---|---|---|---|
Synonyms |
tetT; TetT
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tetT
|
||||
Sequence |
MKIINIGILAHVDAGKTTVTEGLLYKSGAINKIGRVDNATTTTDSMELERDRGITIRAST
VSFNYNDTKVNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEGIQVQTKVIFNTLVKLN IPTLIFVNKIDRKGVCLDEIYTQIQEKLTSNLAIMQSVKIKDKGDFELTNVRDDKVIQSQ IIEKLLDINDYLAEKYINGDVIAEKEYNDVFLDEINNCNLYPVFHGSALKNIGIDELLFA ITKYLPTKSYNTEDLLSAYVYKIDRDEKSRKMTFLRVFSGNIRTRQDVYINGTEETFKIK SLESIMNGEIVKVGQVNSGDIAIISNANSLKIGDYIGKKYDGILDIKIAQPALRASIKPC DLSKRSKLIEALFELTEEDPFLDCEINGDTGEIILRLFGNIQMEVIESLLKSRYKIDARF GELKTIYKERPKRNSKAVIHIEVPPNPYWASIGLSIEPLPIGSGLLYKTEVSYGYLNNSF QNAVKDAVEKACKEGLYGWEVTDLKVTFDYGLYYSPVSTPSDFRNLTPYVFWEALRKAGT EILEPYLKYTVQVPNDFCGRVMSDLRKMRASIEDIIAKGEETTLSGKIPVDTSKSYQSEL LSYSNGKGIFITEPYGYDIYNDKPIINDIGNDNNDSNKEGLRYLFQKQDEN Click to Show/Hide
|
||||
Function |
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Minocycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain TG1 | 562 | ||
Streptococcus agalactiae strain B130 | 1311 | |||
Streptococcus anginosus strain MG16 | 1328 | |||
Streptococcus anginosus strain MG23 | 1328 | |||
Streptococcus anginosus strain MG32 | 1328 | |||
Streptococcus bovis strain D135 | 1335 | |||
Streptococcus bovis strain D295 | 1335 | |||
Streptococcus equisimilis strain C94 | 119602 | |||
Streptococcus equisimilis strain C95 | 119602 | |||
Streptococcus equisimilis strain C96 | 119602 | |||
Streptococcus pyogenes strain A498 | 1314 | |||
Streptococcus sp. strain G59 | 1306 | |||
Experiment for Molecule Alteration |
PCR | |||
Mechanism Description | The gene tet(T) was isolated from Streptococcus pyogenes A498, and the nucleotide sequence that was necessary and sufficient for the expression of tetracycline resistance in Escherichia coli was determined. The deduced Tet(T) protein consists of 651 amino acids. A phylogenetic analysis revealed that Tet T represents a novel branching order among the Tet determinants so far described. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Rifapentine | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain TG1 | 562 | ||
Streptococcus agalactiae strain B130 | 1311 | |||
Streptococcus anginosus strain MG16 | 1328 | |||
Streptococcus anginosus strain MG23 | 1328 | |||
Streptococcus anginosus strain MG32 | 1328 | |||
Streptococcus bovis strain D135 | 1335 | |||
Streptococcus bovis strain D295 | 1335 | |||
Streptococcus equisimilis strain C94 | 119602 | |||
Streptococcus equisimilis strain C95 | 119602 | |||
Streptococcus equisimilis strain C96 | 119602 | |||
Streptococcus pyogenes strain A498 | 1314 | |||
Streptococcus sp. strain G59 | 1306 | |||
Experiment for Molecule Alteration |
PCR | |||
Mechanism Description | The gene tet(T) was isolated from Streptococcus pyogenes A498, and the nucleotide sequence that was necessary and sufficient for the expression of tetracycline resistance in Escherichia coli was determined. The deduced Tet(T) protein consists of 651 amino acids. A phylogenetic analysis revealed that Tet T represents a novel branching order among the Tet determinants so far described. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.