Molecule Information
General Information of the Molecule (ID: Mol01050)
Name |
Polyamine transporter 1 (TPO1)
,Saccharomyces cerevisiae
|
||||
---|---|---|---|---|---|
Synonyms |
YLL028W; L0939
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
TPO1
|
||||
Gene ID | |||||
Sequence |
MSDHSPISNKENHLLPSDSSRSSSSDMHSTGTTGTTGVEPVDFTGEGAKYTTATEGNGGA
DLAIQRTTTMNSAAESEVNITRRLTKILTGSVNEPDRVEVDYTNCAPMGGDRPYPPSLPS RDLYEVTFDGPNDPLHPFNWPMKKKVLLCLVLCLDSIAIAMCSSIFASAVPQICEIYHVI EVVAILGITLFVLGFAASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFI CRFFGGFIGAAPMAVVPAAFADMFDTNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTW RWLEYVVGCFASAVFVAIVLFFEETHHPTILVNKAKQMRKQSNNWGIHAAHEDVELSIKD IVQKTVTRPIIMLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENGELPYIA LIIGMMVCAAFIWYMDNDYLKRCRAKGKLVPEARLYAMVIAGTVFPIGILWFCWTGYYPH KIHWMVPTVGGAFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPLFAG YMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGESIRKKSKYAYAA Click to Show/Hide
|
||||
Function |
Cell membrane polyamine/proton antiporter, involved in the detoxification of excess polyamines in the cytoplasm. Catalyzes polyamine uptake at alkaline pH and excretion at acidic pH. Recognizes spermidine, spermine and putrescine, the polyamine analogs methylglyoxal bis(guanylhydrazone) (MGBG) and paraquat, the antimalarial drug quinidine, and cycloheximide. Confers resistance to the non-steroidal anti-inflammatory drug indomethacin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Fungal infection | [1] | |||
Resistant Disease | Fungal infection [ICD-11: 1F29-1F2F] | |||
Resistant Drug | Benzoic acid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Saccharomyces cerevisiae 23344c | 4932 | ||
Saccharomyces cerevisiae BY4741 | 1247190 | |||
Saccharomyces cerevisiae BY4741_gcn4del | 1247190 | |||
Saccharomyces cerevisiae BY4741_pdr1del | 1247190 | |||
Saccharomyces cerevisiae BY4741_pdr3del | 1247190 | |||
Saccharomyces cerevisiae BY4741_pdr8del | 1247190 | |||
Saccharomyces cerevisiae BY4741_stp1del | 1247190 | |||
Saccharomyces cerevisiae BY4741_stp2del | 1247190 | |||
Saccharomyces cerevisiae BY4741_tpo1del | 1247190 | |||
Saccharomyces cerevisiae BY4741_war1del | 1247190 | |||
Saccharomyces cerevisiae BY4741_yap1del | 1247190 | |||
Saccharomyces cerevisiae BY4741_yap2del | 1247190 | |||
Saccharomyces cerevisiae BY4741_yap3del | 1247190 | |||
Saccharomyces cerevisiae BY4741_yap4del | 1247190 | |||
Saccharomyces cerevisiae BY4741_yap5del | 1247190 | |||
Experiment for Molecule Alteration |
RT-PCR | |||
Experiment for Drug Resistance |
Benzoic acid susceptibility assay | |||
Mechanism Description | The Saccharomyces cerevisiae multidrug transporter Tpo1 was demonstrated to confer resistance to benzoic acid. TPO1 transcript levels were shown to be up-regulated in yeast cells suddenly exposed to this stress agent. This up-regulation is under the control of the Gcn4 and Stp1 transcription factors, involved in the response to amino acid availability, but not under the regulation of the multidrug resistance transcription factors Pdr1 and Pdr3 that have binding sites in TPO1 promoter. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.