General Information of the Molecule (ID: Mol01047)
Name
Plasmepsin II (PMII) ,Plasmodium falciparum
Synonyms
PLM II; Aspartic hemoglobinase II; PfAPD; PfPM1; Plasmepsin 2
    Click to Show/Hide
Molecule Type
Protein
Gene Name
PMII
Sequence
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
    Click to Show/Hide
Function
During the asexual blood stage, participates in initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation. May cleave preferentially denatured hemoglobin that has been cleaved by PMI. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity (Probable).
    Click to Show/Hide
Uniprot ID
PLM2_PLAFX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium falciparum
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Piperaquine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Malaria [1]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Piperaquine
Molecule Alteration Missense mutation + Chromosome variation
PfCRT p.F145I+p.G353V+p.I218F + pfpm2 Amplification
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium falciparum strains 5833
Experiment for
Molecule Alteration
PacBio amplicon sequencing assay; Whole genome sequencing assay
Experiment for
Drug Resistance
Piperaquine susceptibility testing assay
Mechanism Description Parasites with the Dd2 haplotype and pfpm2 amplification had significantly greater mean log10-transformed piperaquine IC90 compared to Dd2 parasites without pfpm2 amplification (t test, P =.0079). In parasites with newly emerged PfCRT mutations, mean log10-transformed piperaquine IC90 was not significantly different between parasites with or without pfpm2 amplification.
Disease Class: Malaria [1]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Piperaquine
Molecule Alteration Chromosome variation
pfpm2 Amplification+Haplotype
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium falciparum strains 5833
Experiment for
Molecule Alteration
PacBio amplicon sequencing assay; Whole genome sequencing assay
Experiment for
Drug Resistance
Piperaquine susceptibility testing assay
Mechanism Description Parasites with the Dd2 haplotype and pfpm2 amplification had significantly greater mean log10-transformed piperaquine IC90 compared to Dd2 parasites without pfpm2 amplification (t test, P?=?.0079).
References
Ref 1 Distribution and Temporal Dynamics of Plasmodium falciparum Chloroquine Resistance Transporter Mutations Associated With Piperaquine Resistance in Northern Cambodia. J Infect Dis. 2021 Sep 17;224(6):1077-1085. doi: 10.1093/infdis/jiab055.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.