Molecule Information
General Information of the Molecule (ID: Mol01047)
| Name |
Plasmepsin II (PMII)
,Plasmodium falciparum
|
||||
|---|---|---|---|---|---|
| Synonyms |
PLM II; Aspartic hemoglobinase II; PfAPD; PfPM1; Plasmepsin 2
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
PMII
|
||||
| Sequence |
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
During the asexual blood stage, participates in initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation. May cleave preferentially denatured hemoglobin that has been cleaved by PMI. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity (Probable).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Malaria [ICD-11: 1F45.0] | [1] | |||
| Resistant Disease | Malaria [ICD-11: 1F45.0] | |||
| Resistant Drug | Piperaquine | |||
| Molecule Alteration | Missense mutation + Chromosome variation | PfCRT p.F145I+p.G353V+p.I218F + pfpm2 Amplification |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Plasmodium falciparum strains | 5833 | ||
| Experiment for Molecule Alteration |
PacBio amplicon sequencing assay; Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Piperaquine susceptibility testing assay | |||
| Mechanism Description | Parasites with the Dd2 haplotype and pfpm2 amplification had significantly greater mean log10-transformed piperaquine IC90 compared to Dd2 parasites without pfpm2 amplification (t test, P =.0079). In parasites with newly emerged PfCRT mutations, mean log10-transformed piperaquine IC90 was not significantly different between parasites with or without pfpm2 amplification. | |||
| Disease Class: Malaria [ICD-11: 1F45.0] | [1] | |||
| Resistant Disease | Malaria [ICD-11: 1F45.0] | |||
| Resistant Drug | Piperaquine | |||
| Molecule Alteration | Chromosome variation | pfpm2 Amplification+Haplotype |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Plasmodium falciparum strains | 5833 | ||
| Experiment for Molecule Alteration |
PacBio amplicon sequencing assay; Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Piperaquine susceptibility testing assay | |||
| Mechanism Description | Parasites with the Dd2 haplotype and pfpm2 amplification had significantly greater mean log10-transformed piperaquine IC90 compared to Dd2 parasites without pfpm2 amplification (t test, P?=?.0079). | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
