Molecule Information
General Information of the Molecule (ID: Mol01043)
Name |
Phosphatidylglycerol lysyltransferase (MPREF)
,Staphylococcus aureus
|
||||
---|---|---|---|---|---|
Synonyms |
Lysylphosphatidylglycerol synthase; LPG synthase; Multiple peptide resistance factor; fmtC
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
mprF
|
||||
Sequence |
MNQEVKNKIFSILKITFATALFIFVAITLYRELSGINFKDTLVEFSKINRMSLVLLFIGG
GASLVILSMYDVILSRALKMDISLGKVLRVSYIINALNAIVGFGGFIGAGVRAMVYKNYT HDKKKLVHFISLILISMLTGLSLLSLLIVFHVFDASLILDKITWVRWVLYVVSFFLPLFI IYSMVRPPDKNNRFVGLYCTLVSCVEWLAAAVVLYFCGVIVDAHVSFMSFIAIFIIAALS GLVSFIPGGFGAFDLVVLLGFKTLGVPEEKVLLMLLLYRFAYYFVPVIIALILSSFEFGT SAKKYIEGSKYFIPAKDVTSFLMSYQKDIIAKIPSLSLAILVFFTSMIFFVNNLTIVYDA LYDGNHLTYYILLAIHTSACLLLLLNVVGIYKQSRRAIIFAMISILLITVATFFTYASYI LITWLAIIFVLLIVAFRRARRLKRPVRMRNIVAMLLFSLFILYVNHIFIAGTLYALDIYT IEMHTSVLRYYFWLTILIIAIIIGMIAWLFDYQFSKVRISSKIEDCEEIINQYGGNYLSH LIYSGDKQFFTNENKTAFLMYRYKASSLVVLGDPLGDENAFDELLEAFYNYAEYLGYDVI FYQVTDQHMPLYHNFGNQFFKLGEEAIIDLTQFSTSGKKRRGFRATLNKFDELNISFEII EPPFSTEFINELQHVSDLWLDNRQEMHFSVGEFNEEYLSKAPIGVMRNEENEVIAFCSLM PTYFNDAISVDLIRWLPELDLPLMDGLYLHMLLWSKEQGYTKFNMGMATLSNVGQLHYSY LRERLAGRVFEHFNGLYRFQGLRRYKSKYNPNWEPRFLVYRKDNSLWESLSKVMRVIRHK Click to Show/Hide
|
||||
Function |
Catalyzes the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol (PG), which produces lysylphosphatidylglycerol (LPG), a major component of the bacterial membrane with a positive net charge. LPG synthesis contributes to bacterial virulence as it is involved in the resistance mechanism against cationic antimicrobial peptides (CAMP) produces by the host's immune system (defensins, cathelicidins) and by the competing microorganisms (bacteriocins). In fact, the modification of anionic phosphatidylglycerol with positively charged L-lysine results in repulsion of the peptides. Consequently, MprF is shown to affect resistance and susceptibility to moenomycin and vancomycin, resistance to human defensins (HNP1-3) and evasion of oxygen-independent neutrophil killing and susceptibility to methicillin, oxacillin, bacitracin, gentamicin, beta-lactams and synthetic peptides (hBD3, CAP18) and other cationic antimicrobial peptides.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Daptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Experiment for Molecule Alteration |
TLC and Western blotting analysis | |||
Experiment for Drug Resistance |
Epsilometer test (E test) assay | |||
Mechanism Description | MprF does not only synthesize Lys-PG but also accomplishes translocation of Lys-PG from the inner to the outer surface of the membrane. Lys-PG mediates CAMP resistance by repulsing the cationic peptides from the outer surface of the membrane. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Experiment for Molecule Alteration |
TLC and Western blotting analysis | |||
Experiment for Drug Resistance |
Epsilometer test (E test) assay | |||
Mechanism Description | MprF does not only synthesize Lys-PG but also accomplishes translocation of Lys-PG from the inner to the outer surface of the membrane. Lys-PG mediates CAMP resistance by repulsing the cationic peptides from the outer surface of the membrane. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Vancomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Experiment for Molecule Alteration |
TLC and Western blotting analysis | |||
Experiment for Drug Resistance |
Epsilometer test (E test) assay | |||
Mechanism Description | MprF does not only synthesize Lys-PG but also accomplishes translocation of Lys-PG from the inner to the outer surface of the membrane. Lys-PG mediates CAMP resistance by repulsing the cationic peptides from the outer surface of the membrane. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus aureus infection | [1] | |||
Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
Resistant Drug | Moenomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Experiment for Molecule Alteration |
TLC and Western blotting analysis | |||
Experiment for Drug Resistance |
Epsilometer test (E test) assay | |||
Mechanism Description | MprF does not only synthesize Lys-PG but also accomplishes translocation of Lys-PG from the inner to the outer surface of the membrane. Lys-PG mediates CAMP resistance by repulsing the cationic peptides from the outer surface of the membrane. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.