Molecule Information

General Information of the Molecule (ID: Mol01029)

• Name: Outer membrane porin C (OMPC) ,Escherichia coli
• Synonyms: Outer membrane protein 1B; Outer membrane protein C; Porin OmpC; meoA; par; b2215; JW2203
• Molecule Type: Protein
• Gene Name: ompC
• Gene ID: 946716
• Sequence:
  MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLG
  FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
  VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGE
  GFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAE
  TYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQ
  SKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVA
  LGLVYQF
• Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.; FUNCTION: (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.
• Uniprot ID: OMPC_ECOLI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Cefazolin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cefazolin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli 1422; 562
• In Vitro Model: Escherichia coli 1437; 562
• In Vitro Model: Escherichia coli B1343; 562
• In Vitro Model: Escherichia coli B1350; 562
• In Vitro Model: Escherichia coli B1421; 562
• In Vitro Model: Escherichia coli pop1010; 562
• Experiment for Drug Resistance: Disk diffusion test assay
• Mechanism Description: Permeability of the outer membrane to lowmolecular-weight hydrophilic molecules is due to the presence of porin protein molecules such as OmpF and OmpC, which form pores in the outer membrane that allow small molecules to diffuse rapidly into the periplasmic space.The case of cephaloridine and cefazolin is remarkable because mutants lacking the OmpF or the OmpC proteins individually were as susceptible to cefaloridine and cefazolin as was the wild type, but mutants lacking both proteins were resistant to these Beta-lactams.

Cephaloridine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cephaloridine
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli 1422; 562
• In Vitro Model: Escherichia coli 1437; 562
• In Vitro Model: Escherichia coli B1343; 562
• In Vitro Model: Escherichia coli B1350; 562
• In Vitro Model: Escherichia coli B1421; 562
• In Vitro Model: Escherichia coli pop1010; 562
• Experiment for Drug Resistance: Disk diffusion test assay
• Mechanism Description: Permeability of the outer membrane to lowmolecular-weight hydrophilic molecules is due to the presence of porin protein molecules such as OmpF and OmpC, which form pores in the outer membrane that allow small molecules to diffuse rapidly into the periplasmic space.The case of cephaloridine and cefazolin is remarkable because mutants lacking the OmpF or the OmpC proteins individually were as susceptible to cefaloridine and cefazolin as was the wild type, but mutants lacking both proteins were resistant to these Beta-lactams.

Triclosan

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Escherichia coli infection [4]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Triclosan
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: E. coli IFN4; 562
• Experiment for Molecule Alteration: Microarray hybridization assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Concerning up-regulated porins and transporters (ompF, ompC, ykgG, ydjXYZ), they can either provide an efflux mechanism to export triclosan from the cells or accelerate the import of triclosan into the cytoplasm before the cell membrane is destabilized, thereby contributing to increasing the MICs of triclosan.

References

• Ref 1: Antibiotic stress, genetic response and altered permeability of E. coli. PLoS One. 2007 Apr 11;2(4):e365. doi: 10.1371/journal.pone.0000365.
• Ref 2: Adaptive and mutational resistance: role of porins and efflux pumps in drug resistance. Clin Microbiol Rev. 2012 Oct;25(4):661-81. doi: 10.1128/CMR.00043-12.
• Ref 3: Role of porin proteins OmpF and OmpC in the permeation of beta-lactams. Antimicrob Agents Chemother. 1982 Dec;22(6):942-8. doi: 10.1128/AAC.22.6.942.
• Ref 4: Signature gene expression profile of triclosan-resistant Escherichia coli. J Antimicrob Chemother. 2010 Jun;65(6):1171-7. doi: 10.1093/jac/dkq114. Epub 2010 Apr 21.