Molecule Information

General Information of the Molecule (ID: Mol01026)

• Name: Oleandomycin glycosyltransferase oleI (OLEL) ,Streptomyces antibioticus
• Synonyms: oleI; Oleandomycin glycosyltransferase
• Molecule Type: Protein
• Gene Name: oleI
• Sequence:
  MTSEHRSASVTPRHISFFNIPGHGHVNPSLGIVQELVARGHRVSYAITDEFAAQVKAAGA
  TPVVYDSILPKESNPEESWPEDQESAMGLFLDEAVRVLPQLEDAYADDRPDLIVYDIASW
  PAPVLGRKWDIPFVQLSPTFVAYEGFEEDVPAVQDPTADRGEEAAAPAGTGDAEEGAEAE
  DGLVRFFTRLSAFLEEHGVDTPATEFLIAPNRCIVALPRTFQIKGDTVGDNYTFVGPTYG
  DRSHQGTWEGPGDGRPVLLIALGSAFTDHLDFYRTCLSAVDGLDWHVVLSVGRFVDPADL
  GEVPPNVEVHQWVPQLDILTKASAFITHAGMGSTMEALSNAVPMVAVPQIAEQTMNAERI
  VELGLGRHIPRDQVTAEKLREAVLAVASDPGVAERLAAVRQEIREAGGARAAADILEGIL
  AEAG
• 3D-structure: PDB ID: 2IYA; Classification: Transferase; Method: X-ray diffraction; Resolution: 1.70 Å
• Uniprot ID: Q3HTL7_STRAT

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces antibioticus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Matromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces infection [ICD-11: 1C43.6] [1]

• Resistant Disease: Streptomyces infection [ICD-11: 1C43.6]
• Resistant Drug: Matromycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli C41(DE3); 469008
• Experiment for Molecule Alteration: Linked enzyme activity assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Glycosylation of macrolide antibiotics confers host cell immunity from endogenous and exogenous agents. The Streptomyces antibioticus glycosyltransferases, OleI, glycosylate and inactivate oleandomycin.

References

• Ref 1: The crystal structure of two macrolide glycosyltransferases provides a blueprint for host cell antibiotic immunity. Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5336-41. doi: 10.1073/pnas.0607897104. Epub 2007 Mar 21.