Molecule Information
General Information of the Molecule (ID: Mol01019)
| Name |
Multifunctional fusion protein (LPXA)
,Acinetobacter baumannii
|
||||
|---|---|---|---|---|---|
| Synonyms |
(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Beta-hydroxyacyl-ACP dehydratase; (3R)-hydroxymyristoyl-ACP dehydrase; UDP-N-acetylglucosamine acyltransferase; fabZ; lpxA; NCTC13305_00288
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
lpxA_2
|
||||
| Sequence |
MTESTTPKFAIPELPMQIQTIRQYLPHRYPFLLVDRVTEVTDNSIVGYKNVSINEEFLQG
HFPEYPIMPGVLIVEALAQVSGVLGFIMNNETPKPGSLFLFAGAERVRFKKQVVAGDQLV LKSELVMQKRGIYKYNCTASVDGIVAATAEIMISHQKNRAGMSNHDLIHSTAIIDPSAVI ASDVQIGPYCIIGPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVGEVCQDLKYKGE ETWLEIGNNNLIREHCSLHRGTVQDNALTKIGSHNLLMVNTHIAHDCIVGDHNIFANNVG VAGHVHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIE GMRRKGWSKNTIQGLREAYKLIFKSGLTSVQAIEQIKSEILPSVPEAQLLIDSLEQSERG IVR Click to Show/Hide
|
||||
| Function |
Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.90del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.H159D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1844 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | c.700C>T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1845 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.G68D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1846 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.391_421del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.Q72K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1848 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.76_78del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.364_809del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.90del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.H159D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1844 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | c.700C>T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1845 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.G68D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1846 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.391_421del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.Q72K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1848 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.76_78del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter meningitis [ICD-11: 1D01.1] | [1], [2] | |||
| Resistant Disease | Acinetobacter meningitis [ICD-11: 1D01.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.364_809del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.90del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.H159D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1844 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | c.700C>T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1845 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.G68D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1846 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.391_421del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.Q72K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1848 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.76_78del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.364_809del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.90del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.H159D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1844 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | c.700C>T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1845 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.G68D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1846 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.391_421del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.Q72K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AL1848 | 470 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.76_78del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
| Disease Class: Acinetobacter baumannii infection [ICD-11: CA40.4] | [1], [2] | |||
| Resistant Disease | Acinetobacter baumannii infection [ICD-11: CA40.4] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Frameshift mutation | c.364_809del |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii ATCC 19606 | 575584 | ||
| Acinetobacter baumannii FADDI008 | 470 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | A critical first step in the action of polymyxins is the electrostatic interaction between the positively charged peptide and the negatively charged lipid A, the endotoxic component of lipopolysaccharide (LPS).A. baumannii type strain ATCC 19606, colistin-resistant variants contain mutations within genes essential for lipid A biosynthesis (either lpxA, lpxC, or lpxD) and that these strains have lost the ability to produce lipid A and therefore LPS. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
