General Information of the Molecule (ID: Mol01010)
Name
Multidrug efflux SMR transporter (ABES) ,Acinetobacter baumannii
Synonyms
abeS; emrE_2; A7M90_04670; CBE85_00325; CSB70_2397; FJU36_01990; G3N53_09785; ITE13_14185; NCTC13305_03610; Multidrug efflux SMR transporter AbeS; QacE family quaternary ammonium compound efflux SMR transporter; QacEdelta1 SMR family efflux pump; Small Multidrug Resistance family protein; Transporter
    Click to Show/Hide
Molecule Type
Protein
Gene Name
abeS
Gene ID
66396571
Sequence
MSYLYLAIAIACEVIATSALKASQGFTIPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYA
IWSGAGIILISAIGWIFYKQHLDLAACIGLALMIAGIVIINVFSKNTHL
    Click to Show/Hide
Uniprot ID
A0A090B1X4_ACIBA
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Amikacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Erythromycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Novobiocin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Novobiocin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Tetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Tetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
Trimethoprim
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Acinetobacter baumannii infection [1]
Resistant Disease Acinetobacter baumannii infection [ICD-11: CA40.4]
Resistant Drug Trimethoprim
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32 562
Experiment for
Molecule Alteration
Fluorometric efflux assay
Experiment for
Drug Resistance
Broth dilution assay
Mechanism Description The abeS gene product conferred resistance to various antimicrobial compounds through an efflux mechanism.
References
Ref 1 Role of AbeS, a novel efflux pump of the SMR family of transporters, in resistance to antimicrobial agents in Acinetobacter baumannii. Antimicrob Agents Chemother. 2009 Dec;53(12):5312-6. doi: 10.1128/AAC.00748-09. Epub 2009 Sep 21.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.