Molecule Information
      General Information of the Molecule (ID: Mol01003)
  
  | Name | Metallo-beta-lactamase NDM-4 (NDM4)
                                ,Escherichia coli
                               | ||||
|---|---|---|---|---|---|
| Synonyms | bla(NDM-4); blaNDM-4; NDM-4; NDM-4; New Delhi metallo-beta-lactamase NDM-4     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | bla(NDM-4) | ||||
| Sequence | MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ticarcillin | |||
| Molecule Alteration | Missense mutation | p.M154L | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli I5 | 562 | ||
| Experiment for Molecule Alteration | Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance | Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | A clinical Escherichia coli isolate resistant to all Beta-lactams, including carbapenems, expressed a novel metallo-Beta-lactamase (MBL), NDM-4, differing from NDM-1 by a single amino acid substitution (Met154Leu). NDM-4 possessed increased hydrolytic activity toward carbapenems and several cephalosporins compared to that of NDM-1. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
