Molecule Information
General Information of the Molecule (ID: Mol01002)
| Name |
Metallo-beta-lactamase (VIM1)
,Achromobacter denitrificans
|
||||
|---|---|---|---|---|---|
| Synonyms |
blaVIM-1; VIM-1 metallo-beta-lactamase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
blaVIM-1
|
||||
| Sequence |
MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV GGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS TDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGH GLPGGLDLLQHTANVVKAHKNRSVAE Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
9 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Aztreonam | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Aztreonam | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefepime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Cefepime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Meropenem | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Meropenem | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Mezlocillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Mezlocillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Piperacillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Piperacillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Imipenem | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | A. xylosoxydans AX22 exhibited broad-spectrum resistance to Beta-lactams and aminoglycosides. The Beta-lactam resistance pattern (including piperacillin, ceftazidime, and carbapenem resistance) was unusual for this species, and the high-level carbapenem resistance suggested the production of an acquired carbapenemase. In fact, carbapenemase activity was detected in a crude extract of AX22 (specific activity, 184 +/- 12 U/mg of protein), and this activity was reduced (>80%) after incubation of the crude extract with 2 mM EDTA, suggesting the presence of a metallo-Beta-lactamase determinant. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Imipenem | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli | 668369 | ||
| Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
| Escherichia coli MkD-135 | 562 | |||
| Pseudomonas aeruginosa 10145/3 | 287 | |||
| Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Electroporation of Escherichia coli DH5alpha with the purified plasmid preparation yielded ampicillin-resistant transformants which contained a plasmid apparently identical to pAX22 (data not shown). DH5alpha(pAX22) produced carbapenemase activity (specific activity of crude extract, 202 +/- 14 U/mg of protein) and, compared to DH5alpha, exhibited a decreased susceptibility to several Beta-lactams. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
