Molecule Information

General Information of the Molecule (ID: Mol01001)

• Name: Metallo beta lactamase (TMB1) ,Achromobacter xylosoxidans
• Synonyms: tmb-1; Metallo beta lactamase
• Molecule Type: Protein
• Gene Name: tmb-1
• Sequence:
  MRPFLFLIIFISHFAFANEEIPGLEVEEIDNGVFLHKSYSRVEGWGLVSSNGLVVISGGK
  AFIIDTPWSESDTEKLVDWIRSKKYELAGSISTHSHEDKTAGIKWLNGKSITTYASALTN
  EILKREGKEQARSSFKGNEFSLMDGFLEVYYPGGGHTIDNLVVWIPSSKILYGGCFIRSL
  ESSGLGYTGEAKIDQWPQSARNTISKYPEAKIVVPGHGKIGDFELLKHTKVLAEKASNKA
  NHGDR
• Uniprot ID: E7BCS5_9BURK

Kingdom: N.A.
Phylum: Proteobacteria
Class: Betaproteobacteria
Order: Burkholderiales
Family: Alcaligenaceae
Genus: Achromobacter
Species: Achromobacter xylosoxidans

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Ceftazidime

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Ceftazidime
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Achromobacter xylosoxidans AES301; 85698
• In Vitro Model: Escherichia coli J53; 1144303
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Etest assay
• Mechanism Description: These enzymes very efficiently hydrolyze all Beta-lactams, including carbapenems (with the exception of aztreonam), and the Beta-lactamase genes most often are located on transferable genetic platforms, namely, either ISCR elements or class 1 integrons sometimes embedded in Tn21- or Tn402-like transposons.A novel MBL, TMB-1 (for Tripoli metallo-Beta-lactamase) can inactivate the antibiotics.

References

• Ref 1: Genetic and biochemical characterization of a novel metallo-Beta-lactamase, TMB-1, from an Achromobacter xylosoxidans strain isolated in Tripoli, Libya. Antimicrob Agents Chemother. 2012 May;56(5):2241-5. doi: 10.1128/AAC.05640-11. Epub 2012 Jan 30.