Molecule Information
General Information of the Molecule (ID: Mol00993)
Name |
Macrolide-lincosamide-streptogramin B resistance protein (ERMA)
,Streptococcus pyogenes
|
||||
---|---|---|---|---|---|
Synonyms |
rRNA adenine N-6-methyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
erm(A)
|
||||
Sequence |
MKQKNPKNTQNFITSKKHVKEILKYTNINKQDKIIEIGSGKGHFTKELVEMSQRVNAIEI
DEGLFM Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Clarithromycin | |||
Molecule Alteration | Methylation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Macrolide resistance commonly occurs due to methylation of the macrolide-binding site on the ribosome by methyltransferases encoded by the erm group of genes, Induction of erm(A) occurs by translational attenuationInduction of erm(A) occurs by translational attenuation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Methylation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Macrolide resistance commonly occurs due to methylation of the macrolide-binding site on the ribosome by methyltransferases encoded by the erm group of genes, Induction of erm(A) occurs by translational attenuationInduction of erm(A) occurs by translational attenuation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Methylation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Macrolide resistance commonly occurs due to methylation of the macrolide-binding site on the ribosome by methyltransferases encoded by the erm group of genes, Induction of erm(A) occurs by translational attenuationInduction of erm(A) occurs by translational attenuation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Spiramycin | |||
Molecule Alteration | Methylation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Macrolide resistance commonly occurs due to methylation of the macrolide-binding site on the ribosome by methyltransferases encoded by the erm group of genes, Induction of erm(A) occurs by translational attenuationInduction of erm(A) occurs by translational attenuation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Telithromycin | |||
Molecule Alteration | Methylation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Macrolide resistance commonly occurs due to methylation of the macrolide-binding site on the ribosome by methyltransferases encoded by the erm group of genes, Induction of erm(A) occurs by translational attenuationInduction of erm(A) occurs by translational attenuation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Zithromax | |||
Molecule Alteration | Missense mutation | Macrolide-binding site on the ribosome |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | E. coli transformed with mutant erm(A) harbouring G98A, A137C or C140T mutations (phenotypes 1 and 2) did not express high-level azithromycin or clindamycin resistance. | |||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Zithromax | |||
Molecule Alteration | Missense mutation | p.G98A |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | E. coli transformed with mutant erm(A) harbouring G98A, A137C or C140T mutations (phenotypes 1 and 2) did not express high-level azithromycin or clindamycin resistance. | |||
Disease Class: Streptococcus pyogenes infection | [1] | |||
Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Zithromax | |||
Molecule Alteration | Missense mutation | p.A137C |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli AG100A | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | E. coli transformed with mutant erm(A) harbouring G98A, A137C or C140T mutations (phenotypes 1 and 2) did not express high-level azithromycin or clindamycin resistance. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.