Molecule Information
      General Information of the Molecule (ID: Mol00991)
  
  | Name | Macrolide 2'-phosphotransferase II (MPHB)
                                ,Escherichia coli
                               | ||||
|---|---|---|---|---|---|
| Synonyms | mphB; mph(B); BON70_03915; DAH50_23490; GF147_25890; GF147_27035; HVY77_26855; pO103_99; B) family macrolide 2'-phosphotransferase     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | mphB | ||||
| Sequence | MSKDIKQVIEIAKKHNLFLKEETIQFNESGLDFQAVFAQDNNGIDWVLRLPRREDVMPRT KVEKQALDLVNKYAISFQAPNWIIYTEELIAYKKLDGVPAGTIDHNIGNYIWEIDINNVP ELFHKSLGRVLAELHSIPSNKAAALDLVVHTPEEARMSMKQRMDAVRAKFGVGENLWNRW QAWLNDDDMWPKKTGLIHGDVHAGHTMIDKDANVTGLIDWTEAKVTDVSHDFIFNYRAFG EEGLEALILAYKEIGGYYWPKMKEHIIELNAAYPVSIAEFALVSGIEEYEQMAKEALEVQ GS     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      3 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1], [2], [3] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli AG100A | 562 | ||
| Escherichia coli DB10 | 562 | |||
| Escherichia coli TOP10 | 83333 | |||
| Escherichia coli XL1-Blue | 562 | |||
| Staphylococcus aureus RN4220 | 1280 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | Agar dilution method assay | |||
| Mechanism Description | Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1], [2], [3] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Spiramycin | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli AG100A | 562 | ||
| Escherichia coli DB10 | 562 | |||
| Escherichia coli TOP10 | 83333 | |||
| Escherichia coli XL1-Blue | 562 | |||
| Staphylococcus aureus RN4220 | 1280 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | Agar dilution method assay | |||
| Mechanism Description | Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1], [2], [3] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Telithromycin | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli AG100A | 562 | ||
| Escherichia coli DB10 | 562 | |||
| Escherichia coli TOP10 | 83333 | |||
| Escherichia coli XL1-Blue | 562 | |||
| Staphylococcus aureus RN4220 | 1280 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | Agar dilution method assay | |||
| Mechanism Description | Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
