Molecule Information
General Information of the Molecule (ID: Mol00988)
| Name |
Lincosamide nucleotidyltransferase (LNUG)
,Enterococcus faecalis
|
||||
|---|---|---|---|---|---|
| Synonyms |
lnu(G); lnuG; EY666_09475; G)
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
lnu(G)
|
||||
| Sequence |
MLKQKELMARVKELVQSDERISACMMYGSFTKGEGDQYSDIEYYVFLKDDTISTFDSAKW
LNEVASYTLLYQNEYGTEVVIFENLIRGEFHFLSENEMNIIPSFKESGYIPDTKAMFIYD ETGQLELYLSELEGPGPNRLTEENVNFLLNNFSNLWLMGINVLKRGENARSLELLSQLQK NILQLIRIAEENADNWFNMTKNLEKEISPENYEKFKKTTARLNELELYEAYKNSLLLVME LRNLVEKQYQLTISDDFLGKLFNYMNE Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Enterococcus faecalis infection | [1] | |||
| Resistant Disease | Enterococcus faecalis infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Lincomycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Enterococcus faecalis | 1351 | ||
| Experiment for Molecule Alteration |
PCR; DNA sequence assay | |||
| Mechanism Description | A novel resistance gene, designated lnu(G), which encodes a putative lincosamide nucleotidyltransferase, was found in E. faecalis E531. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
