Molecule Information
      General Information of the Molecule (ID: Mol00980)
  
  | Name | Isocitrate lyase 1 (ICL1)
                                ,Mycobacterium tuberculosis
                               | ||||
|---|---|---|---|---|---|
| Synonyms | ICL1; Isocitrase; Isocitratase; Methylisocitrate lyase; MICA; MT0483     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | icl1 | ||||
| Gene ID | |||||
| Sequence | MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG STEEGQFH     Click to Show/Hide | ||||
| Function | Involved in the persistence and virulence of M.tuberculosis. Catalyzes the reversible formation of succinate and glyoxylate from isocitrate, a key step of the glyoxylate cycle, which operates as an anaplerotic route for replenishing the tricarboxylic acid cycle during growth on fatty acid substrates. It also catalyzes the formation of pyruvate and succinate from 2-methylisocitrate, a key step in the methylcitrate cycle (propionate degradation route).     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: HIV-infected patients with tuberculosis | [1] | |||
| Resistant Disease | HIV-infected patients with tuberculosis [ICD-11: 1C60.0] | |||
| Resistant Drug | Isoniazid | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Mycobacterium tuberculosis strains | 1773 | ||
| Experiment for Molecule Alteration | qRT-PCR | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | Despite targeting diverse cellular processes, all three drugs trigger activation of Mtb's isocitrate lyases (ICLs), metabolic enzymes commonly assumed to be involved in replenishing of tricarboxylic acid (TCA) cycle intermediates. We further show that ICL-deficient Mtb strains are significantly more susceptible than wild-type Mtb to all three antibiotics, and that this susceptibility can be chemically rescued when Mtb is co-incubated with an antioxidant. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: HIV-infected patients with tuberculosis | [1] | |||
| Sensitive Disease | HIV-infected patients with tuberculosis [ICD-11: 1C60.0] | |||
| Sensitive Drug | Isoniazid | |||
| Molecule Alteration | Expression | Down-regulation | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Mycobacterium tuberculosis strains | 1773 | ||
| Experiment for Molecule Alteration | qRT-PCR | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | Despite targeting diverse cellular processes, all three drugs trigger activation of Mtb's isocitrate lyases (ICLs), metabolic enzymes commonly assumed to be involved in replenishing of tricarboxylic acid (TCA) cycle intermediates. We further show that ICL-deficient Mtb strains are significantly more susceptible than wild-type Mtb to all three antibiotics, and that this susceptibility can be chemically rescued when Mtb is co-incubated with an antioxidant. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
