Molecule Information
General Information of the Molecule (ID: Mol00978)
| Name |
Imipenem-hydrolyzing beta-lactamase (NMCA)
,Enterobacter cloacae
|
||||
|---|---|---|---|---|---|
| Synonyms |
Carbapenemase; NMC-A
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
nmcA
|
||||
| Sequence |
MSLNVKQSRIAILFSSCLISISFFSQANTKGIDEIKNLETDFNGRIGVYALDTGSGKSFS
YRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSL GDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDER DTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSC GAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Hydrolyzes carbapenems such as imipenem, which are extended-spectrum beta-lactam antibiotics.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Enterobacter cloacae infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Enterobacter cloacae infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli strain JM109 | 83333 | ||
| Enterobacter cloacae strain NOR-1 | 550 | |||
| Experiment for Molecule Alteration |
Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Here we report a gene encoding a carbapenemase, which was cloned from the chromosome of a clinical isolate of Enterobacter cloacae, strain NOR-1, into pACYC184 plasmid in Escherichia coli. Unlike all the sequenced carbapenemases, which are class B metallo-beta-lactamases, the mature protein (NmcA) is a class A serine beta-lactamase. NmcA shares the highest amino acid identity (50%) with the extended-spectrum class A beta-lactamase MEN-1 from Escherichia coli. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
