Molecule Information

General Information of the Molecule (ID: Mol00964)

• Name: Flavin-dependent monooxygenase (TETX3) ,Acinetobacter baumannii
• Synonyms: TetX monooxygenase; TetX
• Molecule Type: Protein
• Gene Name: tet(X3)
• Sequence:
  MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTL
  DLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFDNPEINRNDL
  RAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVILANGGMSKIRSFVTD
  TQVEETGTFNIQADILQPEINCPGFFQLCNGNRLMAGHQGILLFANPNNNGALYLGISFK
  TPDEWKNKIPLDFQDRNSVADFLLKRFSKWSEVYKQLIRSVSTFQCLPTRKFPLNNDWKS
  NRPLPITMIGDAAHLMSPFAGQGVNTGLLDALILSENLTNGEFTSIENAIENYEQQMFVY
  AKDTQDESTENETEMFSPNFSFQKLLNL
• Function: An FAD-requiring monooxygenase active on some tetracycline antibiotic derivatives, which leads to their inactivation. Hydroxylates carbon 11a of tetracycline and some analogs.
• Uniprot ID: A0A7D5G3X7_ACISP

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tigecycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Acinetobacter specie infection [1]

• Resistant Disease: Acinetobacter specie infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tigecycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Acinetobacter baumannii 34AB; 509173
• In Vitro Model: Escherichia coli 47EC; 562
• In Vivo Model: ICR female mice model; Mus musculus
• Experiment for Molecule Alteration: Genome extraction and sequencing assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet(X3) and Tet(X4) inactivate all tetracyclines, including tigecycline and the newly FDA-approved eravacycline and omadacycline.

Disease Class: Enterobacteriaceae infection [1]

• Resistant Disease: Enterobacteriaceae infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tigecycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Acinetobacter baumannii 34AB; 509173
• In Vitro Model: Escherichia coli 47EC; 562
• In Vivo Model: ICR female mice model; Mus musculus
• Experiment for Molecule Alteration: Genome extraction and sequencing assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet(X3) and Tet(X4) inactivate all tetracyclines, including tigecycline and the newly FDA-approved eravacycline and omadacycline.

References

• Ref 1: Emergence of plasmid-mediated high-level tigecycline resistance genes in animals and humans. Nat Microbiol. 2019 Sep;4(9):1450-1456. doi: 10.1038/s41564-019-0445-2. Epub 2019 May 27.