Molecule Information
General Information of the Molecule (ID: Mol00961)
Name |
Ethidium resistance protein (EMRE)
,Pseudomonas aeruginosa
|
||||
---|---|---|---|---|---|
Synonyms |
qacF; emrE; CAZ10_01525; CGU42_14710; DT376_08255; E4V10_08075; E5D53_06015; ECC04_029850; GNQ48_04330; IPC111_10130; IPC112_11955; IPC113_21010; IPC114_15435; IPC115_21895; IPC116_07445; IPC117_13035; IPC118_14365; IPC119_19225; IPC120_13415; IPC121_04700; IPC122_19705; IPC123_10700; IPC124_11850; IPC125_15685; IPC126_12045; IPC127_24310; IPC128_20585; IPC1295_07910; IPC129_22120; IPC1306_06520; IPC1307_14550; IPC130_21585; IPC1310_15780; IPC1311_13730; IPC1312_14020; IPC1313_14790; IPC1314_17675; IPC1315_15730; IPC1316_01990; IPC1317_20870; IPC1318_01540; IPC1319_01565; IPC131_00995; IPC1320_07235; IPC1321_15480; IPC1322_06185; IPC1323_06805; IPC1324_06810; IPC1325_01560; IPC1326_01560; IPC1327_01560; IPC1328_13205; IPC1329_15165; IPC132_05115; IPC1331_04465; IPC1332_13740; IPC1333_09990; IPC1334_11330; IPC1335_04920; IPC1336_07425; IPC1337_01650; IPC1338_15555; IPC1339_15375; IPC133_01565; IPC1340_13945; IPC1341_14405; IPC1342_01455; IPC1343_01565; IPC1345_09540; IPC1346_10675; IPC1347_04740; IPC1348_15570; IPC1349_00690; IPC134_00990; IPC135_01565; IPC137_20225; IPC139_07480; IPC140_04920; IPC141_01570; IPC143_06390; IPC144_06980; IPC145_01570; IPC146_06075; IPC1474_13830; IPC1476_06705; IPC1477_09170; IPC1478_04470; IPC1479_12565; IPC147_09320; IPC1480_11880; IPC1481_04360; IPC1482_01560; IPC1485_07045; IPC1486_02225; IPC1487_07880; IPC1489_06135; IPC148_11425; IPC1491_01620; IPC1494_11855; IPC1495_07595; IPC1496_05945; IPC1498_15600; IPC1499_06665; IPC149_06070; IPC1500_12105; IPC1501_14840; IPC1502_13785; IPC1503_13850; IPC1504_10570; IPC1505_01855; IPC1506_20965; IPC1507_20265; IPC1508_06345; IPC1509_09460; IPC150_09060; IPC1510_00930; IPC1511_09015; IPC1512_18795; IPC1513_06930; IPC1514_15400; IPC1515_16655; IPC1516_11610; IPC1517_06880; IPC1518_03930; IPC1519_06065; IPC151_09050; IPC1520_02015; IPC1521_06525; IPC1522_06240; IPC152_06975; IPC153_01570; IPC154_20580; IPC155_21475; IPC156_20655; IPC157_24080; IPC1583_06300; IPC1584_09385; IPC1585_01565; IPC1586_10105; IPC1587_05785; IPC1588_02005; IPC1589_11005; IPC158_25780; IPC1591_01565; IPC1592_01565; IPC1593_15130; IPC1594_10140; IPC1595_01840; IPC1596_06255; IPC1597_05910; IPC1598_05700; IPC1599_10710; IPC159_23025; IPC1600_01560; IPC1601_14200; IPC1602_05240; IPC1603_06525; IPC1604_15475; IPC1605_01175; IPC1606_08240; IPC161_06535; IPC162_16675; IPC163_15040; IPC164_15490; IPC165_15045; IPC166_16360; IPC167_14665; IPC168_21810; IPC169_15065; IPC170_15355; IPC171_09885; IPC172_01565; IPC173_01565; IPC174_02320; IPC175_04885; IPC176_01995; IPC177_03335; IPC178_10800; IPC179_01345; IPC180_01560; IPC181_01560; IPC182_13570; IPC183_05820; IPC184_18590; IPC26_05280; IPC27_14305; IPC29_05570; IPC30_06520; IPC31_07745; IPC32_10065; IPC33_14965; IPC34_05855; IPC35_05850; IPC36_10190; IPC37_09220; IPC38_06130; IPC40_05280; IPC41_01565; IPC42_01565; IPC43_13675; IPC44_12655; IPC45_05550; IPC46_05360; IPC47_01590; IPC48_01565; IPC49_01565; IPC50_01565; IPC51_05220; IPC54_16865; IPC55_14250; IPC56_15165; IPC574_07455; IPC575_15630; IPC576_09675; IPC577_11880; IPC578_07460; IPC579_07895; IPC57_05485; IPC580_15420; IPC582_07450; IPC584_16115; IPC586_07465; IPC589_16680; IPC58_01625; IPC596_09650; IPC597_05335; IPC598_07825; IPC599_10385; IPC59_13705; IPC600_07530; IPC601_10040; IPC602_10460; IPC603_01580; IPC604_01560; IPC605_01560; IPC606_23180; IPC607_09455; IPC608_04710; IPC609_12330; IPC60_12915; IPC610_07855; IPC611_01565; IPC612_01560; IPC613_01560; IPC614_08185; IPC615_01570; IPC616_01570; IPC618_01570; IPC620_01590; IPC621_00465; IPC622_11400; IPC623_13455; IPC624_01560; IPC625_12015; IPC627_08180; IPC629_13880; IPC630_06460; IPC632_02000; IPC633_00980; IPC634_02000; IPC64_14630; IPC65_01470; IPC66_07820; IPC67_01570; IPC68_01575; IPC70_15470; IPC71_04780; IPC72_08430; IPC737_05875; IPC73_07640; IPC74_18665; JEV80_16765; NCTC13621_03545; PA52Ts2_0763; PAMH19_2703; Multidrug efflux SMR transporter; Multidrug transporter; SMR multidrug efflux transporter
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
qacF
|
||||
Sequence |
MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVY
AIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Homidium bromide | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli pXZL1582 | 668369 | ||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Luria-Bertani (LB) broth and agar dilution assay | |||
Mechanism Description | EmrE can pump out toxic compounds such as methyl viologen and play an important role in the intrinsic resistance of P. aeruginosa to aminoglycosides and cationic dyes. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.