General Information of the Molecule (ID: Mol00957)
Name
Erythromycin esterase (EREA2) ,Providencia stuartii
Synonyms
ereA2; Erythromycin esterase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
ereA2
Sequence
MTWRTTRTLLQPQKLEFNEFEILNPVVEGARIVGIGEGAHFVAEFSLARASLIRYFVERH
DFNAIGLECGAIQASRLSEWLNSTAGAHELERFSDTLTFSLYGSVLIWVKSYLRESGRKL
QLVGIDLPNTLNPRDDLAQLAEIIQVIDHLMKPHVDALTQLLTSIDGQSAVISSAKWGEL
ETAQQEKAISGVTRLKLRLASLAPVLKNHVNSDFFRKASDRIESIEYTLETLRVMKAFFD
GTSLEGDTSVRDSYMAGVVDGMVRANPDVRIILLAHNNHLQKTPVSFSGELTAVPMGQHL
AEREEGDYRAIAFTHLGLTVPEMHFPSPDSPLGFSVVTTPADAIREDSVEQYVIDACGKE
DSCLTLTDDPMEAKRMRSQSASVETNLSEAFDAIVCVPSAGKDSLVAL
    Click to Show/Hide
Uniprot ID
Q9ZFJ8_PROST
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Morganellaceae
Genus: Providencia
Species: Providencia stuartii
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clarithromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Community-acquired pneumonia [1]
Resistant Disease Community-acquired pneumonia [ICD-11: CA40.2]
Resistant Drug Clarithromycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21(DE3) 469008
Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Disk diffusion test assay; E-strip test assay
Mechanism Description One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB.
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Community-acquired pneumonia [1]
Resistant Disease Community-acquired pneumonia [ICD-11: CA40.2]
Resistant Drug Erythromycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21(DE3) 469008
Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Disk diffusion test assay; E-strip test assay
Mechanism Description One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB.
Roxithromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Community-acquired pneumonia [1]
Resistant Disease Community-acquired pneumonia [ICD-11: CA40.2]
Resistant Drug Roxithromycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21(DE3) 469008
Escherichia coli TOP10 83333
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Disk diffusion test assay; E-strip test assay
Mechanism Description One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB.
References
Ref 1 Mechanism and diversity of the erythromycin esterase family of enzymes. Biochemistry. 2012 Feb 28;51(8):1740-51. doi: 10.1021/bi201790u. Epub 2012 Feb 10.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.