Molecule Information
General Information of the Molecule (ID: Mol00957)
| Name |
Erythromycin esterase (EREA2)
,Providencia stuartii
|
||||
|---|---|---|---|---|---|
| Synonyms |
ereA2; Erythromycin esterase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ereA2
|
||||
| Sequence |
MTWRTTRTLLQPQKLEFNEFEILNPVVEGARIVGIGEGAHFVAEFSLARASLIRYFVERH
DFNAIGLECGAIQASRLSEWLNSTAGAHELERFSDTLTFSLYGSVLIWVKSYLRESGRKL QLVGIDLPNTLNPRDDLAQLAEIIQVIDHLMKPHVDALTQLLTSIDGQSAVISSAKWGEL ETAQQEKAISGVTRLKLRLASLAPVLKNHVNSDFFRKASDRIESIEYTLETLRVMKAFFD GTSLEGDTSVRDSYMAGVVDGMVRANPDVRIILLAHNNHLQKTPVSFSGELTAVPMGQHL AEREEGDYRAIAFTHLGLTVPEMHFPSPDSPLGFSVVTTPADAIREDSVEQYVIDACGKE DSCLTLTDDPMEAKRMRSQSASVETNLSEAFDAIVCVPSAGKDSLVAL Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Community-acquired pneumonia [ICD-11: CA40.2] | [1] | |||
| Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
| Resistant Drug | Clarithromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli TOP10 | 83333 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Community-acquired pneumonia [ICD-11: CA40.2] | [1] | |||
| Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli TOP10 | 83333 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Community-acquired pneumonia [ICD-11: CA40.2] | [1] | |||
| Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
| Resistant Drug | Roxithromycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli TOP10 | 83333 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
