General Information of the Molecule (ID: Mol00955)
Name
Erm methyltransferase (ERM42) ,Pasteurella multocida
Synonyms
erm(42); rRNA methylase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
erm(42)
Sequence
MNKNTKIKNKNFNIKDSQNFLHNTKLVEDLLFKSNITKEDFVVEIGPGKGIITKALSKIC
KAVNAIEFDSVLADKLSHEFKSSNVSIIEADFLKYNLPDHNYKVFSNIPFNITASILNKL
LDSENPPLDTFLIMQYEPFLKYAGAPSYKESYKSLLYKPFFKTNILHSFSKFDFKPAPNA
NIILGQFSYKDFTDINLEDRHAWKDFLAFVFLEKGVTFKEKTKRIFSYKQQKIILKESRI
NDDSNISNWSYEFWLKMFKLYNSNMVSKDKKVLVNNSYKRMLEHESSLEKIHRNRKQNNR
K
    Click to Show/Hide
Uniprot ID
E5BDA4_PASMD
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pasteurellales
Family: Pasteurellaceae
Genus: Pasteurella
Species: Pasteurella multocida
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clindamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Pasteurella multocida infection [1]
Resistant Disease Pasteurella multocida infection [ICD-11: 1B99.0]
Resistant Drug Clindamycin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli ATCC 25922 1322345
Staphylococcus aureus ATCC 29213 1280
Pasteurella multocida 36950 1075089
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The analysis of one representative P. multocida isolate identified an 82 kb integrative and conjugative element (ICE) integrated into the chromosomal DNA. This ICE, designated ICEPmu1, harboured 11 resistance genes, which confer resistance to streptomycin/spectinomycin (aadA25), streptomycin (strA and strB), gentamicin (aadB), kanamycin/neomycin (aphA1), tetracycline [tetR-tet(H)], chloramphenicol/florfenicol (floR), sulphonamides (sul2), tilmicosin/clindamycin [erm(42)] or tilmicosin/tulathromycin [msr(E)-mph(E)].
Tilmicosin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Pasteurella multocida infection [1]
Resistant Disease Pasteurella multocida infection [ICD-11: 1B99.0]
Resistant Drug Tilmicosin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli ATCC 25922 1322345
Staphylococcus aureus ATCC 29213 1280
Pasteurella multocida 36950 1075089
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The analysis of one representative P. multocida isolate identified an 82 kb integrative and conjugative element (ICE) integrated into the chromosomal DNA. This ICE, designated ICEPmu1, harboured 11 resistance genes, which confer resistance to streptomycin/spectinomycin (aadA25), streptomycin (strA and strB), gentamicin (aadB), kanamycin/neomycin (aphA1), tetracycline [tetR-tet(H)], chloramphenicol/florfenicol (floR), sulphonamides (sul2), tilmicosin/clindamycin [erm(42)] or tilmicosin/tulathromycin [msr(E)-mph(E)].
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sulphonamides
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Pasteurella multocida infection [1]
Resistant Disease Pasteurella multocida infection [ICD-11: 1B99.0]
Resistant Drug Sulphonamides
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli ATCC 25922 1322345
Staphylococcus aureus ATCC 29213 1280
Pasteurella multocida 36950 1075089
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The analysis of one representative P. multocida isolate identified an 82 kb integrative and conjugative element (ICE) integrated into the chromosomal DNA. This ICE, designated ICEPmu1, harboured 11 resistance genes, which confer resistance to streptomycin/spectinomycin (aadA25), streptomycin (strA and strB), gentamicin (aadB), kanamycin/neomycin (aphA1), tetracycline [tetR-tet(H)], chloramphenicol/florfenicol (floR), sulphonamides (sul2), tilmicosin/clindamycin [erm(42)] or tilmicosin/tulathromycin [msr(E)-mph(E)].
References
Ref 1 ICEPmu1, an integrative conjugative element (ICE) of Pasteurella multocida: analysis of the regions that comprise 12 antimicrobial resistance genes. J Antimicrob Chemother. 2012 Jan;67(1):84-90. doi: 10.1093/jac/dkr406. Epub 2011 Oct 14.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.