Molecule Information
General Information of the Molecule (ID: Mol00954)
| Name |
Enterococcal surface protein (ESP)
,Enterococcus faecalis
|
||||
|---|---|---|---|---|---|
| Synonyms |
esp; Fragment
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
esp
|
||||
| Sequence |
DSWLSDTNKKLIQNTYGTGYYYLQDIDGDGNPDDKEESGDTNPYIGKPELEEVYDVDTTV
KGKVFIHELAGTGHKAQLVDKEGTVLAEKTIAPNEKDGAPISDTVEFEFTGVDSSKLIAK DELKIQIVSPGFDKPEEGSTVIKESPKAVDKQTVVVGFKPDA Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Enterococci faecium infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Enterococci faecium infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterococcus faecalis strain JH2-2 | 1320322 | ||
| Enterococcus faecalis strain pIP1326g | 1351 | |||
| Enterococcus faecalis strain pIP655 | 1351 | |||
| Enterococcus faecalis strain pIP683 | 1351 | |||
| Enterococcus faecalis strain pIP687 | 1351 | |||
| Enterococcus faecium strain pIP1182 | 1352 | |||
| Enterococcus faecium strain pIP1535 | 1352 | |||
| Enterococcus faecium strain pIP1538 | 1352 | |||
| Enterococcus faecium strain pIP1539 | 1352 | |||
| Enterococcus faecium strain pIP1687 | 1352 | |||
| Enterococcus faecium strain pIP713 | 1352 | |||
| Streptococci strain A451 | 36470 | |||
| Streptococci strain A453 | 36470 | |||
| Streptococci strain A456 | 36470 | |||
| Streptococci strain B109 | 1319 | |||
| Streptococci strain B117 | 1319 | |||
| Streptococci strain B118 | 1319 | |||
| Streptococci strain B120 | 1319 | |||
| Streptococci strain B126 | 1319 | |||
| Streptococci strain B127 | 1319 | |||
| Streptococci strain BM132 | 1319 | |||
| Streptococci strain BM137 | 36470 | |||
| Streptococci strain BM140 | 1319 | |||
| Streptococci strain G44 | 1320 | |||
| Streptococci strain G52 | 1320 | |||
| Streptococci strain G54 | 1320 | |||
| Experiment for Molecule Alteration |
Southern blotting assay | |||
| Mechanism Description | An assay based on the utilization of degenerate primers that enable enzymatic amplification of an internal fragment of cat genes known to be present in gram-positive cocci was developed to identify the genes encoding chloramphenicol resistance in streptococci and enterococci. The functionality of this system was illustrated by the detection of cat genes belonging to four different hydridization classes represented by the staphylococcal genes catpC221, catpC194, catpSCS7, and the clostridial gene catP, and by the characterization of a new streptococcal cat gene designated catS. | |||
| Disease Class: Enterococci faecalisc infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Enterococci faecalisc infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterococcus faecalis strain JH2-2 | 1320322 | ||
| Enterococcus faecalis strain pIP1326g | 1351 | |||
| Enterococcus faecalis strain pIP655 | 1351 | |||
| Enterococcus faecalis strain pIP683 | 1351 | |||
| Enterococcus faecalis strain pIP687 | 1351 | |||
| Enterococcus faecium strain pIP1182 | 1352 | |||
| Enterococcus faecium strain pIP1535 | 1352 | |||
| Enterococcus faecium strain pIP1538 | 1352 | |||
| Enterococcus faecium strain pIP1539 | 1352 | |||
| Enterococcus faecium strain pIP1687 | 1352 | |||
| Enterococcus faecium strain pIP713 | 1352 | |||
| Streptococci strain A451 | 36470 | |||
| Streptococci strain A453 | 36470 | |||
| Streptococci strain A456 | 36470 | |||
| Streptococci strain B109 | 1319 | |||
| Streptococci strain B117 | 1319 | |||
| Streptococci strain B118 | 1319 | |||
| Streptococci strain B120 | 1319 | |||
| Streptococci strain B126 | 1319 | |||
| Streptococci strain B127 | 1319 | |||
| Streptococci strain BM132 | 1319 | |||
| Streptococci strain BM137 | 36470 | |||
| Streptococci strain BM140 | 1319 | |||
| Streptococci strain G44 | 1320 | |||
| Streptococci strain G52 | 1320 | |||
| Streptococci strain G54 | 1320 | |||
| Experiment for Molecule Alteration |
Southern blotting assay | |||
| Mechanism Description | An assay based on the utilization of degenerate primers that enable enzymatic amplification of an internal fragment of cat genes known to be present in gram-positive cocci was developed to identify the genes encoding chloramphenicol resistance in streptococci and enterococci. The functionality of this system was illustrated by the detection of cat genes belonging to four different hydridization classes represented by the staphylococcal genes catpC221, catpC194, catpSCS7, and the clostridial gene catP, and by the characterization of a new streptococcal cat gene designated catS. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
