Molecule Information
      General Information of the Molecule (ID: Mol00949)
  
  | Name | Elongation factor Tu (TUF)
                                ,Clostridioides difficile
                               | ||||
|---|---|---|---|---|---|
| Synonyms | EF-Tu; tufA; CD630_00580; tufB; CD630_00710     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | tuf1 | ||||
| Gene ID | |||||
| Sequence | MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEAVDFANIDKAPEERER GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSATDGPMPQTREH ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYDFPGDDTPIVRGSALMAL EDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFSITGRGTVATGRVERGVLK VQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTG SVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGACKLPEGIEMVMPGDNV TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE     Click to Show/Hide | ||||
| Function | This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Clinical Trial Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | LFF571 | |||
| Molecule Alteration | Missense mutation | p.G260E | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Clostridium difficile strain ATCC 43255 | 499175 | ||
| Clostridium difficile strain NB95002 | 1496 | |||
| Clostridium difficile strain NB95026 | 1496 | |||
| Clostridium difficile strain NB95031 | 1496 | |||
| Clostridium difficile strain NB95047 | 1496 | |||
| Experiment for Drug Resistance | Agar dilution method assay | |||
| Mechanism Description | Selection on inhibitory concentrations of LFF571 resulted in a substitution at the C. difficile residue analogous to G257 in E. coli EF-Tu.All mutants exhibited tufB mutation G782A, resulting in amino acid substitution G260E; NB95013-JAL0759 harbored the G782A change in both tufA and tufB. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
