Molecule Information
General Information of the Molecule (ID: Mol00939)
| Name |
DNA-directed RNA polymerase subunit beta (RPOB)
,Staphylococcus aureus
|
||||
|---|---|---|---|---|---|
| Synonyms |
RNAP subunit beta; RNA polymerase subunit beta; Transcriptase subunit beta; SAOUHSC_00524
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
rpoB
|
||||
| Gene ID | |||||
| Sequence |
MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL VKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGAGGIVLDVKVFNREEGDDT LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD Click to Show/Hide
|
||||
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.A473T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.Q468K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.D471Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L+p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.A473T+p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifabutin | |||
| Molecule Alteration | Missense mutation | p.D471Y+p.S486L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.A473T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.Q468K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.D471Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L+p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.H481N+p.A473T+p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifampin | |||
| Molecule Alteration | Missense mutation | p.D471Y+p.S486L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.A473T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.Q468K |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.D471Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.H481N+p.L466S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.H481N+p.I527M |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.H481N+p.S529L+p.Q465R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.H481N+p.A473T+p.A477T |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
| Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] | [1] | |||
| Resistant Disease | Staphylococcus aureus infection [ICD-11: 1B54.0] | |||
| Resistant Drug | Rifapentine | |||
| Molecule Alteration | Missense mutation | p.D471Y+p.S486L |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Staphylococcus aureus strain T109 | 1280 | ||
| Staphylococcus aureus strain T112 | 1280 | |||
| Staphylococcus aureus strain T113 | 1280 | |||
| Staphylococcus aureus strain T115 | 1280 | |||
| Staphylococcus aureus strain T118 | 1280 | |||
| Staphylococcus aureus strain T124 | 1280 | |||
| Staphylococcus aureus strain T161 | 1280 | |||
| Staphylococcus aureus strain T166 | 1280 | |||
| Staphylococcus aureus strain T20 | 1280 | |||
| Staphylococcus aureus strain T211 | 1280 | |||
| Staphylococcus aureus strain T212 | 1280 | |||
| Staphylococcus aureus strain T23 | 1280 | |||
| Staphylococcus aureus strain T236 | 1280 | |||
| Staphylococcus aureus strain T23aa | 1280 | |||
| Staphylococcus aureus strain T23aac | 1280 | |||
| Staphylococcus aureus strain T23bb | 1280 | |||
| Staphylococcus aureus strain T248 | 1280 | |||
| Staphylococcus aureus strain T249 | 1280 | |||
| Staphylococcus aureus strain T25 | 1280 | |||
| Staphylococcus aureus strain T250 | 1280 | |||
| Staphylococcus aureus strain T262 | 1280 | |||
| Staphylococcus aureus strain T264 | 1280 | |||
| Staphylococcus aureus strain T295 | 1280 | |||
| Staphylococcus aureus strain T296 | 1280 | |||
| Staphylococcus aureus strain T297 | 1280 | |||
| Staphylococcus aureus strain T36 | 1280 | |||
| Staphylococcus aureus strain T38 | 1280 | |||
| Staphylococcus aureus strain T382 | 1280 | |||
| Staphylococcus aureus strain T38aa | 1280 | |||
| Staphylococcus aureus strain T38bb | 1280 | |||
| Staphylococcus aureus strain T397 | 1280 | |||
| Staphylococcus aureus strain T398 | 1280 | |||
| Staphylococcus aureus strain T399 | 1280 | |||
| Staphylococcus aureus strain T4 | 1280 | |||
| Staphylococcus aureus strain T400 | 1280 | |||
| Staphylococcus aureus strain T401 | 1280 | |||
| Staphylococcus aureus strain T402 | 1280 | |||
| Staphylococcus aureus strain T403 | 1280 | |||
| Staphylococcus aureus strain T404 | 1280 | |||
| Staphylococcus aureus strain T46 | 1280 | |||
| Staphylococcus aureus strain T59 | 1280 | |||
| Staphylococcus aureus strain T66 | 1280 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Twelve mutational changes at 10 positions were identified, with 473Ala-Thr representing a new mutation site. New amino acid substitutions, 465Gln-Arg, 466Leu-Ser, 468Gln-Lys, and 477Ala-Thr in cluster I and 527Ile-Met and 529Ser-Leu in cluster II, were described, thereby emphasizing the high variability of these amino acid positions. Codon 481 was mutated on 32 separate occasions, which indicates a central role of this amino acid. All in vivo isolates that demonstrated two or three amino acid changes exhibited high-level resistance. Interestingly enough, all of these isolates showed the mutational change 481His-Asn, which is capable of conferring low-level resistance on its own, thereby indicating a two-step resistance mechanism in vivo to high-level resistance within these isolates. High-level resistance in vivo, however, was not demonstrated to occur through multiple mutations alone. The single amino acid substitution 468Gln-Lys also causes high-level resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
