Molecule Information
General Information of the Molecule (ID: Mol00918)
Name |
DNA gyrase subunit A (GYRA)
,Ureaplasma urealyticum
|
||||
---|---|---|---|---|---|
Synonyms |
UUR2_0088
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
gyrA
|
||||
Gene ID | |||||
Sequence |
MALKKPKKSRLTTEEIKQQLEGSTIKEQSITKEVETSFLDYSMSVIVARALPDVRDGFKP
VHRRALFAAFENGMTHDKPYKKSARWVGDVIGKYHPHGDQAVYQTIVRMAQEFSMRYLLV DGHGNFGSIDGDSAAAMRYTEARLSKISYELLKYIDKETVDFVPNYDASEQEPSVLPSGF PNLLTNGTTGIAVGMATNIPPHNLTEVCQAIKAYAKNHDISIPEIMEHLKGPDFPTGAEI YGDSGIINYFNTGRGSVTIRSKYEIEDIGQGRVAIVVTEIPYMVNKVNLIEKIVELVTNK QIEGISDLRDESSRDGIRIVIEVKRDVIPEVLLNKLFKTTALQTNFSVNNLALVNGVPMV LNIKEMIKYYFEHQIEVLVRRTKFDLRKAKERIHIVEGLVIAVNNIDEVIKIIKASGDDD IASKALIARFGLTELQTKAILEMRLRALTGLNIDKLKKEYEDLLLIIEDLEDILENYDRQ VNIICENLDYLIEKFGDERRTEIMYGVSSHIDDEDLIPVEDIVVTMSKRGYFKRLPIDTY KNQRRGGVGVQGLKTYEDDDVEKILVANTHTDLLFFSDLGRVYRLRGHEVPLGSRQSKGI PAINFLPIEKSESILTILPIDNYEQGSLFFTTSKGIIKRANLSDFESIRANGKIAITLKE GDKLFSVMQTLGNDEVFIGASNGNVIRFNENDAREMGRIATGVKGINLEDDEYVVGTGLS SHGEYVLAVGSKGLGKLTDINDYRLTKRGAKGVNTLKVNDRTGNLVSIKVVNRDEEALII TTSGKVIRLSIQDISVIGRNTSGVKLISLENKEEVKSIAIFKKEEIDDNDDEQKTSHGNE HNLE Click to Show/Hide
|
||||
Function |
A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Ureaplasma urealyticum infection | [1], [2] | |||
Resistant Disease | Ureaplasma urealyticum infection [ICD-11: 1A81.2] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Missense mutation | p.S83L |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli k-12 JM109 | 83333 | ||
Ureaplasma parvum serovar 3 isolates | 38504 | |||
Ureaplasma parvum serovar 6 isolates | 95660 | |||
Ureaplasma urealyticum isolates | 2130 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | Quinolones are used for treating urogenital infections and interact in bacteria with the type II topoisomerases DNA gyrase and topoisomerase IV, both of which are composed of two A and two B subunits; these subunits are encoded by the gyrA and gyrB genes for DNA gyrase and parC and parE genes for topoisomerase IV.Out of 28 clinical Ureaplasma strains, we isolated 9 with high MICs of quinolones and found a single parC gene mutation, resulting in the change S83L. | |||
Disease Class: Ureaplasma urealyticum infection | [1], [2] | |||
Resistant Disease | Ureaplasma urealyticum infection [ICD-11: 1A81.2] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Missense mutation | p.S83L |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli k-12 JM109 | 83333 | ||
Ureaplasma parvum serovar 3 isolates | 38504 | |||
Ureaplasma parvum serovar 6 isolates | 95660 | |||
Ureaplasma urealyticum isolates | 2130 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | Quinolones are used for treating urogenital infections and interact in bacteria with the type II topoisomerases DNA gyrase and topoisomerase IV, both of which are composed of two A and two B subunits; these subunits are encoded by the gyrA and gyrB genes for DNA gyrase and parC and parE genes for topoisomerase IV.Out of 28 clinical Ureaplasma strains, we isolated 9 with high MICs of quinolones and found a single parC gene mutation, resulting in the change S83L. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.