Molecule Information
      General Information of the Molecule (ID: Mol00906)
  
  | Name | Dihydrofolate reductase type 6 (DFRA6)
                                ,Proteus mirabilis
                               | ||||
|---|---|---|---|---|---|
| Synonyms | Dihydrofolate reductase type VI; dfrVI     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | dhfrVI | ||||
| Sequence | MKISLMAAVSENGVIGSGLDIPWHVQGEQLLFKAMTYNQWLLVGRKTFDSMGKLPNRKYA VVTRSKIISNDPDVVYFASVESALAYLNNATAHIFVSGGGEIYKALIDQADVIHLSVIHK HISGDVFFPPVPQGFKQTFEQSFSSNIDYTYQIWAKG     Click to Show/Hide | ||||
| Function | Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis (By similarity).     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Proteus mirabilis infection | [1] | |||
| Resistant Disease | Proteus mirabilis infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain JM101 | 83333 | ||
| Escherichia coli strain k12 JM103 | 83333 | |||
| Proteus mirabilis strain J120 | 584 | |||
| Experiment for Molecule Alteration | Chain termination method assay | |||
| Mechanism Description | High-level resistance to trimethoprim (Tp) (MIC > 1000 mg/L) is mediated by dihydrofolate reductases (DHFRs) which are resistant to the drug, The gene encoding the type VI DHFR was isolated from P. mirabilis strain J120 (pUk672). | |||
| Disease Class: Escherichia coli infection | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain JM101 | 83333 | ||
| Escherichia coli strain k12 JM103 | 83333 | |||
| Proteus mirabilis strain J120 | 584 | |||
| Experiment for Molecule Alteration | Chain termination method assay | |||
| Mechanism Description | High-level resistance to trimethoprim (Tp) (MIC > 1000 mg/L) is mediated by dihydrofolate reductases (DHFRs) which are resistant to the drug, The gene encoding the type VI DHFR was isolated from P. mirabilis strain J120 (pUk672). The hybrid plasmids were transformed into competent Escherichia coli kl2 JM103 and clones containing the DHFR gene were selected on a medium containing trimethoprim lactate (Wellcome) 100 mg/L, ampicillin 100 mg/L, isopropyl-Beta-D-galactoside and 5-bromo-4-chloro-3-indolyl-Beta-D-gal-actopyranoside (X-gal). | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
