Molecule Information
General Information of the Molecule (ID: Mol00904)
| Name |
Dihydrofolate reductase (DHFR)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
dfrA17; BVL39_26665; HmCms169_04568
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
dfrA27
|
||||
| Sequence |
MKISLMAAKARNGVIGCGSDIPWNAKGEQLLFKAITYNQWLLVGRKTFEAMGALPNRKYA
VVSRSGSVATNDDVVVFPSIEAAMRELKTLTNHVVVSGGGEIYKSLIAHADTLHISTIDS EPEGNVFFPEIPKEFNVVFEQEFHSNINYRYQIWQRG Click to Show/Hide
|
||||
| Function |
Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urinary tract infection [ICD-11: GC08.1] | [1] | |||
| Resistant Disease | Urinary tract infection [ICD-11: GC08.1] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli 1387 | 562 | ||
| Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
| Mechanism Description | The most common resistant mechanism involves expressing trimethoprim insensitive variants of DHFR within mobile genetic elements, such as plasmids, transposons and integrons. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
