General Information of the Molecule (ID: Mol00893)
Name
Dihydrofolate reductase (DHFR) ,Pneumocystis jirovecii
Molecule Type
Protein
Gene Name
DHFR
Sequence
MDWQKSLTLIVALTLSRGIGLKNDLPWKLKSDMMFFSRVTSGLLVTRSTGQMNVVLMGRK
TWESLPAHSRPLKNRINVVISRQEVLDLGGGAYHARSLDDALALLSQIYDSTSKIQLNRV
FVIGGGELYKAAMEHSRLNRIIATVIHNEVDCDVFFPIDFRSSQSCLPWRKQDHSVLEAW
VGSKVPQGKINENGFIYEFEMWIRDI
    Click to Show/Hide
Uniprot ID
Q9UUP5_PNEJI
        Click to Show/Hide the Complete Species Lineage
Kingdom: Fungi
Phylum: Ascomycota
Class: Pneumocystidomycetes
Order: Pneumocystidales
Family: Pneumocystidaceae
Genus: Pneumocystis
Species: Pneumocystis jirovecii
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Co-trimoxazole
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pneumocystis jirovecii infection [ICD-11: CA40.6] [1]
Resistant Disease Pneumocystis jirovecii infection [ICD-11: CA40.6]
Resistant Drug Co-trimoxazole
Molecule Alteration Missense mutation
p.T55A
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pneumocytis jirovecii strain 42068
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Multivariate analysis of overall survival or disease-free survival assay
Mechanism Description In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation.
Disease Class: Pneumocystis jirovecii infection [ICD-11: CA40.6] [1]
Resistant Disease Pneumocystis jirovecii infection [ICD-11: CA40.6]
Resistant Drug Co-trimoxazole
Molecule Alteration Missense mutation
p.P57S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pneumocytis jirovecii strain 42068
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Multivariate analysis of overall survival or disease-free survival assay
Mechanism Description In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation.
Disease Class: Pneumocystis jirovecii infection [ICD-11: CA40.6] [1]
Resistant Disease Pneumocystis jirovecii infection [ICD-11: CA40.6]
Resistant Drug Co-trimoxazole
Molecule Alteration Missense mutation
p.T55A+p.P57S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pneumocytis jirovecii strain 42068
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Multivariate analysis of overall survival or disease-free survival assay
Mechanism Description In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation.
Disease Class: HIV-infected Pneumocystis pneumonia [ICD-11: 1C60.1] [2]
Resistant Disease HIV-infected Pneumocystis pneumonia [ICD-11: 1C60.1]
Resistant Drug Co-trimoxazole
Molecule Alteration Missense mutation
p.V96I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pneumocystis jirovecii isolates 42068
Experiment for
Molecule Alteration
nested PCR
Mechanism Description Among the 76 enrolled HIV-positive patients, only 17 (22.4%) were positive for P. jirovecii. DHPS gene sequencing showed a novel nucleotide substitution at position 288 (Val96Ile) in three patients (3/12; 25.0%). Patients infected with the mutant P. jirovecii genotype had severe episodes of PCP, did not respond to SXT and had a fatal outcome.
References
Ref 1 Low prevalence of Pneumocystis pneumonia (PCP) but high prevalence of pneumocystis dihydropteroate synthase (dhps) gene mutations in HIV-infected persons in Uganda. PLoS One. 2012;7(11):e49991. doi: 10.1371/journal.pone.0049991. Epub 2012 Nov 16.
Ref 2 Novel dihydropteroate synthase gene mutation in Pneumocystis jirovecii among HIV-infected patients in India: Putative association with drug resistance and mortality .J Glob Antimicrob Resist. 2019 Jun;17:236-239. doi: 10.1016/j.jgar.2019.01.007. Epub 2019 Jan 15. 10.1016/j.jgar.2019.01.007

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.