Molecule Information
General Information of the Molecule (ID: Mol00893)
Name |
Dihydrofolate reductase (DHFR)
,Pneumocystis jirovecii
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
DHFR
|
||||
Sequence |
MDWQKSLTLIVALTLSRGIGLKNDLPWKLKSDMMFFSRVTSGLLVTRSTGQMNVVLMGRK
TWESLPAHSRPLKNRINVVISRQEVLDLGGGAYHARSLDDALALLSQIYDSTSKIQLNRV FVIGGGELYKAAMEHSRLNRIIATVIHNEVDCDVFFPIDFRSSQSCLPWRKQDHSVLEAW VGSKVPQGKINENGFIYEFEMWIRDI Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pneumocystis jirovecii infection | [1] | |||
Resistant Disease | Pneumocystis jirovecii infection [ICD-11: CA40.6] | |||
Resistant Drug | Co-trimoxazole | |||
Molecule Alteration | Missense mutation | p.T55A |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Pneumocytis jirovecii strain | 42068 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Multivariate analysis of overall survival or disease-free survival assay | |||
Mechanism Description | In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation. | |||
Disease Class: Pneumocystis jirovecii infection | [1] | |||
Resistant Disease | Pneumocystis jirovecii infection [ICD-11: CA40.6] | |||
Resistant Drug | Co-trimoxazole | |||
Molecule Alteration | Missense mutation | p.P57S |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Pneumocytis jirovecii strain | 42068 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Multivariate analysis of overall survival or disease-free survival assay | |||
Mechanism Description | In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation. | |||
Disease Class: Pneumocystis jirovecii infection | [1] | |||
Resistant Disease | Pneumocystis jirovecii infection [ICD-11: CA40.6] | |||
Resistant Drug | Co-trimoxazole | |||
Molecule Alteration | Missense mutation | p.T55A+p.P57S |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Pneumocytis jirovecii strain | 42068 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Multivariate analysis of overall survival or disease-free survival assay | |||
Mechanism Description | In these 5 resistance-fungal isolates and an additional 8 from consecutive cases of PCP, all strains harbored mutant dhps haplotypes; all 13 isolates harbored the P57S mutation in dhps, and 3 (23%) also harbored the T55A mutation. | |||
Disease Class: HIV-infected Pneumocystis pneumonia | [2] | |||
Resistant Disease | HIV-infected Pneumocystis pneumonia [ICD-11: 1C60.1] | |||
Resistant Drug | Co-trimoxazole | |||
Molecule Alteration | Missense mutation | p.V96I |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Pneumocystis jirovecii isolates | 42068 | ||
Experiment for Molecule Alteration |
nested PCR | |||
Mechanism Description | Among the 76 enrolled HIV-positive patients, only 17 (22.4%) were positive for P. jirovecii. DHPS gene sequencing showed a novel nucleotide substitution at position 288 (Val96Ile) in three patients (3/12; 25.0%). Patients infected with the mutant P. jirovecii genotype had severe episodes of PCP, did not respond to SXT and had a fatal outcome. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.