General Information of the Molecule (ID: Mol00892)
Name
D-glucan-1,3-beta--UDP glucosyltransferase (FKS1) ,Candida auris
Synonyms
FKS1; B9J08_000964; CA7LBN_002502; EC 2.4.1.34
    Click to Show/Hide
Molecule Type
Protein
Gene Name
FKS1
Sequence
MSYDNNHNYYDPNQQQGGQPGGEYYQQGAYDEMGQPVNYDQAGDYYDPNQQYQQQPYDMD
GYQNYGQQGAAGYSADPEAFSDFSYGGGHAPGTPGYDQYGAQYTPSQMSYAGARSSGAST
PIYGANPNYDPSQFQLSSNLPYPAWSADPQAPIKIEHIEDIFIDLTNKFGFQRDSMRNMF
DYFMTLLDSRSSRMSPAQALLSLHADYIGGDNANYKKWFFASQQDLDESIGFANMNLGKI
GRKARKASKKSKKARKAAEEHGQDIDALNNELEGDYSMEAANIRWKAKMNVLTPEERVRD
IALYLLLWGEANQVRFTPELICFIFKTALDYLNSPQCQQRQEPVPEGDYLNRIITPIYRF
IRSQVYEIYEGRFVKREKDHNKVIGYDDVNQLFWYPEGISRIIFNDGTRLVDIPMEERYM
RLGEVEWQNIFFKTYKEVRTWLHLVTNFNRIWIIHVTIYWMYTAYNSPTLYTQDYVQTIN
NRPTASSQWSAPAMGGMIASFIEVMATVFEWMFVPREWAGAQHLSRRLVFLIIILVINIV
PFAYSFYWAGLSAISKSAHAVSIVGFFIAVATLLFFAIMPLGGLFTSYMNRRSRKYVASQ
IFTANFHSLRGLDMWMSYLLWVTVFAAKLAESYFFLTLSLRDPIRNLSTMTMRCNGEQWF
GDTLCKHQAKIVLGLMLLVDLFLFFLDTYMWYIICNCVFSIGRSFYLGISILTPWRNIFT
RLPKRIYSKILATTEMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEI
EGKRTLRAPTFFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPILEPLPVDNMPTFTV
FTPHYSEKILLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKILAEETAAYENA
DEEERSNEDGLKAKIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARA
IKLLYRVENPELVQYFGGDPEGLELALEKMARRKFKFVVSMQRLAKFKEDEMENAEFLLR
AYPDLQIAYLDEEPPLNEDEEPRVYSALIDGHCEVLDNGRRRPKFRVQLSGNPILGDGKS
DNQNHAIIFHRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEHVNPYAPGLKNNNDE
KPAPVAILGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNATF
MLTRGGVSKAQKGLHLNEDIYAGMTAMLRGGRIKHCEYYQCGKGRDMGFGSICNFTTKIG
AGMGEQMLSREYYYLSTQLPLDRFLSFYYGHPGFHINNLFIQLSLQTFMLVLANLNSLAH
ESILCDYDRNVPITDPLRPFGCYNLSPAIDWIRRYTLSIFIVFWISFIPLVVQELIERGL
WKATQRFFRHFISLSPMFEVFLAQIYSNSLFTDLTVGGARYISTGRGFATSRIPFSILFS
RFADSAIYMGSRSMLILLFGSVAHWQAPLLWFWASLSALMFSPFLFNPHQFAWEDFFIDY
RDFIRWLSRGNTKWHRNSWIGYIKLSRSRVTGFKRKLTGDISEKSAGDASRAHRSNVFMA
DFLPCLFYAAGLFVAYTYVNAQTGVTRWSVDGRDSTEPIKVNSVVRIVICALAPVVIDIG
CLGVCLGMACCAGPMLGLCCKKTGAVIAGVAHGVAVIVHLVFFIVMWVLEGFNFARMLLG
IVTMIYIQRVLFKILTLLFLTREFKNDKSNTAFWTGKWYNTGMGYMAATQPAREFVAKII
EMSEFAGDFILAHLILFIQLPILCIPLIDRWHSTMLFWLKPSRLIRPPIYSLKQAKLRKR
IVRKYCTLYFAILVLFIVIIAAPAVAGRFIADNLGANMSGTFEGLFQPRKVKNNDTGKVS
SWWSTSDVKITFWSFTPTTSNVYTTKAF
    Click to Show/Hide
Uniprot ID
A0A2H1A4W2_CANAR
        Click to Show/Hide the Complete Species Lineage
Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Metschnikowiaceae
Genus: .
Species: Candida auris
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Anidulafungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida auris infection [1]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Anidulafungin
Molecule Alteration Missense mutation
p.S639P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Broth microdilution assay
Mechanism Description Sequencing of FkS revealed that 4 isolates contain the amino acid substitution S639P and those isolates exhibit the highest MICs to echinocandins (micafungin, caspofungin, and anidulafungin, CD101).
Disease Class: Candida auris infection [2]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Anidulafungin
Molecule Alteration Missense mutation
p.S639F
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
CLSI broth microdilution method assay
Mechanism Description Echinocandin (micafungin, caspofungin, and anidulafungin) resistance was linked to a novel mutation S639F in FkS1 hot spot region I.
Disease Class: Candida auris infection [3]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Anidulafungin
Molecule Alteration Missense mutation
p.S652Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
AFST assay
Mechanism Description One isolate displayed resistance to both echinocandins (micafungin, caspofungin, and anidulafungin) and 5-flucytosine; the former was associated with a serine to tyrosine amino acid substitution in the gene FkS1, and the latter was associated with a phenylalanine to isoleucine substitution in the gene FUR1.
Caspofungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida auris infection [1]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.S639P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Broth microdilution assay
Mechanism Description Sequencing of FkS revealed that 4 isolates contain the amino acid substitution S639P and those isolates exhibit the highest MICs to echinocandins (micafungin, caspofungin, and anidulafungin, CD101).
Disease Class: Candida auris infection [2]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.S639F
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
CLSI broth microdilution method assay
Mechanism Description Echinocandin (micafungin, caspofungin, and anidulafungin) resistance was linked to a novel mutation S639F in FkS1 hot spot region I.
Disease Class: Candida auris infection [3]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.S652Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
AFST assay
Mechanism Description One isolate displayed resistance to both echinocandins (micafungin, caspofungin, and anidulafungin) and 5-flucytosine; the former was associated with a serine to tyrosine amino acid substitution in the gene FkS1, and the latter was associated with a phenylalanine to isoleucine substitution in the gene FUR1.
Micafungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida auris infection [1]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Micafungin
Molecule Alteration Missense mutation
p.S639P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
AFST assay
Mechanism Description Sequencing of FkS revealed that 4 isolates contain the amino acid substitution S639P and those isolates exhibit the highest MICs to echinocandins (micafungin, caspofungin, and anidulafungin, CD101).
Disease Class: Candida auris infection [2]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Micafungin
Molecule Alteration Missense mutation
p.S639F
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
CLSI broth microdilution method assay
Mechanism Description Echinocandin (micafungin, caspofungin, and anidulafungin) resistance was linked to a novel mutation S639F in FkS1 hot spot region I.
Disease Class: Candida auris infection [3]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Micafungin
Molecule Alteration Missense mutation
p.S652Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
AFST assay
Mechanism Description One isolate displayed resistance to both echinocandins (micafungin, caspofungin, and anidulafungin) and 5-flucytosine; the former was associated with a serine to tyrosine amino acid substitution in the gene FkS1, and the latter was associated with a phenylalanine to isoleucine substitution in the gene FUR1.
Rezafungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida auris infection [1]
Resistant Disease Candida auris infection [ICD-11: 1F23.2]
Resistant Drug Rezafungin
Molecule Alteration Missense mutation
p.S639P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida auris strain 498019
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Broth microdilution assay
Mechanism Description Sequencing of FkS revealed that 4 isolates contain the amino acid substitution S639P and those isolates exhibit the highest MICs to echinocandins (micafungin, caspofungin, and anidulafungin, CD101).
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Echinocandins
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Recurrent oropharyngeal candidiasis [4]
Resistant Disease Recurrent oropharyngeal candidiasis [ICD-11: 1F23.6]
Resistant Drug Echinocandins
Molecule Alteration Mutation
p.S645P+p.S645Y+p.S645F
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Candida albicans strain 5476
Mechanism Description For most Candida species, echinocandin resistance is primarily mediated by mutations in the FKS genes. In C. albicans, mutations that confer echinocandin resistance occur in the essential gene, FKS1. Hot-spot regions correspond to amino acids 641-649 (hot spot 1) and amino acids 1357-1364 (hot spot 2). Mutations at these regions decrease the IC50 of the glucan synthase enzyme by several orders of magnitude, elevate MIC values, and result in cross-resistance to diverse echinocandins. In C. albicans, serine 645 (S645) within hot-spot region 1 exhibits the highest frequency of substitution and is associated with the most prominent resistance phenotype.
References
Ref 1 Activity of CD101, a long-acting echinocandin, against clinical isolates of Candida auris. Diagn Microbiol Infect Dis. 2018 Mar;90(3):196-197. doi: 10.1016/j.diagmicrobio.2017.10.021. Epub 2017 Nov 7.
Ref 2 A multicentre study of antifungal susceptibility patterns among 350 Candida auris isolates (2009-17) in India: role of the ERG11 and FKS1 genes in azole and echinocandin resistance. J Antimicrob Chemother. 2018 Apr 1;73(4):891-899. doi: 10.1093/jac/dkx480.
Ref 3 Genomic epidemiology of the UK outbreak of the emerging human fungal pathogen Candida auris. Emerg Microbes Infect. 2018 Mar 29;7(1):43. doi: 10.1038/s41426-018-0045-x.
Ref 4 Antifungal Drug Resistance: Molecular Mechanisms in Candida albicans and Beyond .Chem Rev. 2021 Mar 24;121(6):3390-3411. doi: 10.1021/acs.chemrev.0c00199. Epub 2020 May 22. 10.1021/acs.chemrev.0c00199
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.