Molecule Information
General Information of the Molecule (ID: Mol00890)
Name |
D-glucan-1,3-beta--UDP glucosyltransferase (FKS1)
,Candida glabrata
|
||||
---|---|---|---|---|---|
Synonyms |
FKS1; fks1; AO440_001525; EC 2.4.1.34
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
FKS1
|
||||
Gene ID | |||||
Sequence |
MSYNNNGQQMSDQGYYDNNQGYYQPEDQQNGQAMYGDEGYYDPNISGGDYYNQPPPPPNM
MGQDMENFSDFSSYGPPGVQGYDYQNMNQSGQYTPSQMSYNGDPNSGSSTPIYGNGMSAY DPNAIAMALPNDPYPAWTADSQSPVPIEQIEDVFIDLTNKFGFQRDSMRNMFDHFMTLLD SRTSRMAPDQALLSLHADYIGGDTANYKKWYFAAQLDMDDEVGFRNMSLGKLSRKARKAK KKNKKAMEEANPEDAEDILNKLEGDNSLEAADFRWKTKMNALTPIERVRQIALYLLIWGE ANQVRFTSECLCFIYKCATDYLNSPLCQQRTEPMPEGDYLNRVITPLYRFIRNQVYEIVD GRYVKREKDHHKVIGYDDVNQLFWYPEGIAKIVFEDSTKLIEIPAEERYLRLGEVSWDDV FFKTYKETRSWFHMITNFNRIWIMHVTIFWMYVAYNSPTFYTHNYQQLVNNQPPAAYKWA SAALGGTVASFIQLLATICEWSFVPRKWAGAQHLSRRFWFLCLIFAVNLGPIIFVFAYEK DTVQSKAGHAVAAVMFFVAVATLLFFSVMPLGGLFTSYMQKSTRRYVASQTFTASFAPLH GLDRWLSYLVWVTVFAAKYAESYYFLILSLRDPIRILSTTTMRCTGEYWWGSKLCRHQSK IVLGLMIATDFILFFLDTYLWYIVVNTVFSVGKSFYLGISILTPWRNIFTRLPKRIYSKI LATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPT FFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPMPEPLPVDNMPTFTVLTPHYAERIL LSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGMDDQDPEKEDA LKNQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENP EIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAYPDLQIAYL DEEPPLNEGEEPRIYSALIDGHCEILENGRRRPKFRVQLSGNPILGDGKSDNQNHALIFY RGEYIQLIDANQDNYLEECLKIRSVLAEFEELNAEQVYPYSPGVKYEDQNTNHPVAIVGA REYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFINATFMTTRGGISKA QKGLHLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIGAGMGEQMLSR EYYYLGTQLPIDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLHALAHESIICIYDKN KPKTDVLYPIGCYNFSPAIDWVRRYTLSIFIVFWIAFVPIVVQELIERGLWKATQRFFRH ILSLSPMFEVFAGQIYSSALLSDLTVGGARYISTGRGFATSRIPFSILYSRFAGSAIYMG ARSMLMLLFGTVAHWQAPLLWFWASLSALLFSPFIFNPHQFSWEDFFLDYRDYIRWLSRG NSKYHRNSWIGYVRMARSRITGFKRKLVGDESEKAAGDASRAHRTNLILAEIIPNAIYAA GCFVGFTFINAQTGVKTTDDDRVNSVLRIIICTLAPIVIDIGVLFFVLGMSCCSGPLFGM CCKRTGSVMAGFAHGIAVIVHIGFFIVMWVLEGFNFTRMLLGVVTMIQCQRLIFQCMTVL MLTREFKNDHANTAFWTGKWYGSGFGYMAWTQPTRELTAKVIELSEFAADFVLGHVILFA QFPVLCIPAIDKFHSIMLFWLKPSRQIRPPIYSLKQSRLRKRMVKRYLTLYIIVFLVFAG CIVGPAVASSHVAKDLGHQLTGTFHNLVQPRNVSNNDTGFGISTYSNHYYTHTPSLKTWS TIK Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Anidulafungin | |||
Molecule Alteration | Missense mutation | p.D632G (c.A1895G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Anidulafungin | |||
Molecule Alteration | Missense mutation | p.D632E (c.T1896G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Anidulafungin | |||
Molecule Alteration | Missense mutation | p.D632Y (c.G1894T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Anidulafungin | |||
Molecule Alteration | Missense mutation | p.F625S (c.T1874C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Anidulafungin | |||
Molecule Alteration | Missense mutation | p.S629P (c.T1885C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Caspofungin | |||
Molecule Alteration | Missense mutation | p.D632G (c.A1895G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Caspofungin | |||
Molecule Alteration | Missense mutation | p.D632E (c.T1896G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Caspofungin | |||
Molecule Alteration | Missense mutation | p.D632Y (c.G1894T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Caspofungin | |||
Molecule Alteration | Missense mutation | p.F625S (c.T1874C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Caspofungin | |||
Molecule Alteration | Missense mutation | p.S629P (c.T1885C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Micafungin | |||
Molecule Alteration | Missense mutation | p.D632G (c.A1895G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Micafungin | |||
Molecule Alteration | Missense mutation | p.D632E (c.T1896G) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Micafungin | |||
Molecule Alteration | Missense mutation | p.D632Y (c.G1894T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Micafungin | |||
Molecule Alteration | Missense mutation | p.F625S (c.T1874C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. | |||
Disease Class: Candida glabrata infection | [1] | |||
Resistant Disease | Candida glabrata infection [ICD-11: 1F23.3] | |||
Resistant Drug | Micafungin | |||
Molecule Alteration | Missense mutation | p.S629P (c.T1885C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida glabrata strain | 5478 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
NCCLS method M-27A with broth macrodilution techniques assay | |||
Mechanism Description | Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.