Molecule Information
General Information of the Molecule (ID: Mol00887)
| Name |
D-glucan-1,3-beta--UDP glucosyltransferase (FKS1)
,Candida albicans
|
||||
|---|---|---|---|---|---|
| Synonyms |
GSC1; EC 2.4.1.34
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
GSC1
|
||||
| Sequence |
MSYNDNNNHYYDPNQQGGMPPHQGGEGYYQQQYDDMGQQPHQQDYYDPNAQYQQQPYDMD
GYQDQANYGGQPMNAQGYNADPEAFSDFSYGGQTPGTPGYDQYGTQYTPSQMSYGGDPRS SGASTPIYGGQGQGYDPTQFNMSSNLPYPAWSADPQAPIKIEHIEDIFIDLTNKFGFQRD SMRNMFDYFMTLLDSRSSRMSPAQALLSLHADYIGGDNANYRKWYFSSQQDLDDSLGFAN MTLGKIGRKARKASKKSKKARKAAEEHGQDVDALANELEGDYSLEAAEIRWKAKMNSLTP EERVRDLALYLLIWGEANQVRFTPECLCYIYKSATDYLNSPLCQQRQEPVPEGDYLNRVI TPLYRFIRSQVYEIYDGRFVKREKDHNKVIGYDDVNQLFWYPEGISRIIFEDGTRLVDIP QEERFLKLGEVEWKNVFFKTYKEIRTWLHFVTNFNRIWIIHGTIYWMYTAYNSPTLYTKH YVQTINQQPLASSRWAACAIGGVLASFIQILATLFEWIFVPREWAGAQHLSRRMLFLVLI FLLNLVPPVYTFQITKLVIYSKSAYAVSIVGFFIAVATLVFFAVMPLGGLFTSYMNKRSR RYIASQTFTANYIKLKGLDMWMSYLLWFLVFLAKLVESYFFSTLSLRDPIRNLSTMTMRC VGEVWYKDIVCRNQAKIVLGLMYLVDLLLFFLDTYMWYIICNCIFSIGRSFYLGISILTP WRNIFTRLPKRIYSKILATTEMEIKYKPKVLISQIWNAIVISMYREHLLAIDHVQKLLYH QVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPMPEPLPVDN MPTFTVFTPHYSEKILLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKILAEET AAYENGDDSEKLSEDGLKSKIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGF MNYARAIKLLYRVENPELVQYFGGDPEGLELALERMARRKFRFLVSMQRLSKFKDDEMEN AEFLLRAYPDLQIAYLDEEPALNEDEEPRVYSALIDGHCEMLENGRRRPKFRVQLSGNPI LGDGKSDNQNHAVIFHRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMNVEHVNPYAPNL KSEDNNTKKDPVAFLGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHP DFLNATFMLTRGGVSKAQKGLHLNEDIYAGMNAMMRGGKIKHCEYYQCGKGRDLGFGSIL NFTTKIGAGMGEQMLSREYFYLGTQLPLDRFLSFYYGHPGFHINNLFIQLSLQVFILVLG NLNSLAHEAIMCSYNKDVPVTDVLYPFGCYNIAPAVDWIRRYTLSIFIVFFISFIPLVVQ ELIERGVWKAFQRFVRHFISMSPFFEVFVAQIYSSSVFTDLTVGGARYISTGRGFATSRI PFSILYSRFADSSIYMGARLMLILLFGTVSHWQAPLLWFWASLSALMFSPFIFNPHQFAW EDFFLDYRDFIRWLSRGNTKWHRNSWIGYVRLSRSRITGFKRKLTGDVSEKAAGDASRAH RSNVLFADFLPTLIYTAGLYVAYTFINAQTGVTSYPYEINGSTDPQPVNSTLRLIICALA PVVIDMGCLGVCLAMACCAGPMLGLCCKKTGAVIAGVAHGVAVIVHIIFFIVMWVTEGFN FARLMLGIATMIYVQRLLFKFLTLCFLTREFKNDKANTAFWTGKWYNTGMGWMAFTQPSR EFVAKIIEMSEFAGDFVLAHIILFCQLPLLFIPLVDRWHSMMLFWLKPSRLIRPPIYSLK QARLRKRMVRKYCVLYFAVLILFIVIIVAPAVASGQIAVDQFANIGGSGSIADGLFQPRN VSNNDTGNHRPKTYTWSYLSTRFTGSTTPYSTNPFRV Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Candida albicans infection | [1] | |||
| Resistant Disease | Candida albicans infection [ICD-11: 1F23.Y] | |||
| Resistant Drug | Caspofungin | |||
| Molecule Alteration | Missense mutation | p.S645Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida tropicalis strain NR3 | 5482 | ||
| In Vivo Model | DBA/2J murine model of disseminated candidiasis; DBA/2N murine model of disseminated candidiasis | Mus musculus | ||
| Experiment for Molecule Alteration |
Site-directed mutagenesis; MLST assay | |||
| Experiment for Drug Resistance |
Liquid broth microdilution assay | |||
| Mechanism Description | One group of amino acid substitutions, in the Fks proteins of S. cerevisiae (F639I, V641k, D646Y) and C. albicans (S645F, S645P, S645Y), maps to a short conserved region of ScFks1p and CaFks1p, which lead to caspofungin resistance in the S. cerevisiae and C. albicans as well as C.krusei. | |||
| Disease Class: Candida albicans infection | [1] | |||
| Resistant Disease | Candida albicans infection [ICD-11: 1F23.Y] | |||
| Resistant Drug | Caspofungin | |||
| Molecule Alteration | Missense mutation | p.S645F |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida albicans strain | 5476 | ||
| In Vivo Model | DBA/2J murine model of disseminated candidiasis; DBA/2N murine model of disseminated candidiasis | Mus musculus | ||
| Experiment for Molecule Alteration |
Site-directed mutagenesis; MLST assay | |||
| Experiment for Drug Resistance |
Liquid broth microdilution assay | |||
| Mechanism Description | One group of amino acid substitutions, in the Fks proteins of S. cerevisiae (F639I, V641k, D646Y) and C. albicans (S645F, S645P, S645Y), maps to a short conserved region of ScFks1p and CaFks1p, which lead to caspofungin resistance in the S. cerevisiae and C. albicans as well as C.krusei. | |||
| Disease Class: Candida albicans infection | [2] | |||
| Resistant Disease | Candida albicans infection [ICD-11: 1F23.Y] | |||
| Resistant Drug | Caspofungin | |||
| Molecule Alteration | Missense mutation | p.S645P |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida albicans strain | 5476 | ||
| Experiment for Molecule Alteration |
NGS sequencing assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Amino acid changes in FkS1 may contribute to Candida albicans emerging caspofungin resistance. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
