Molecule Information
General Information of the Molecule (ID: Mol00886)
| Name |
D-glucan-1,3-beta--UDP glucosyltransferase (FKS1)
,Aspergillus fumigatus
|
||||
|---|---|---|---|---|---|
| Synonyms |
FKS
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
FKS
|
||||
| Sequence |
MSGYQQGGGHYNDGYGHQEHGDSFYQDEHGQAYYDHDYGDGYYDRSGYYGPDGNHNQQEG
GYYDAGQPHDDYYGDHYYDQGNGQQGYDNRGRRRGDSEEDSETFSDFTMRSETARAADMD YYGRGDERYNSYADSQYGGRGYGYRPPSSQISYGANRSSGASTPVYGMDYGNALPAGQRS REPYPAWASDGQVPVSKEEIEDIFLDLVNKFGFQRDSMRNMYDHLMTMLDSRASRMTPNQ ALLSLHADYIGGDNANYRRWYFAAHLDLDDAVGFANMKLGKADRKTRKARKAAKKAAQQN PENVEETLEALEGDNSLEAAEYRWKTRMNKMSQHDRVRQLALFLLCWGEANQVRFLPECL CFIFKCADDYYNSPECQNRVEPVEEFTYLNEIITPLYQYCRDQGYEIVDGKYVRRERDHN QIIVSDMNQLFWYPEGIERIALEDKTRLVDIPPAERWTKLKDVVWKKAFFKTYKETRSWF HMITNFNRIWVIHLGAFWFFTAFNAQSLYTDNYQQQVNNKPPGYRIWSAVGFGGALSSFI QIAATICEWMYVPRRWAGAQHLTKRLMFLILVFVINLAPGVFVFAYSKSMGISKTIPLIV GIVHFFVALATFVFFSVMPLGGLFGSYLKKHGRQYVASQTFTASFPRLHGNDMWMSYGLW VCVFGAKLAESYFFLTLSFKDPIRILSPMQIHQCAGVKYIGNVLCHKQPQILLGLMFFMD LTLFFLDSYLWYIICNTVFSVARSFYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKY KPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSF KTEFFPPGSEAERRISFFAQSLSTPMPEPLPVDNMPTFTVLIPHYSEKILLSLREIIRED EPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQFNGEPEKSEKDVAKSKIDDLPFYC IGFKSAAPEYTLRTRIWSSLRSQTLYRTVSGFMNYSRAIKLLYRVENPEVVQMFGGNSEK LERELERMARRKFKIVVSMQRYAKFNKEERENTEFLLRAYPDLQIAYLDEEPPVNEGEEP RLYSALIDGHCELLENGMRKPKFRIQLSGNPILGDGKSDNQNHSIIFYRGEYIQVIDANQ DNYLEECLKIRSVLAEFEELTTDNVSPYTPGIPSTNTNPVAILGAREYIFSENIGVLGDV AAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNGIFMTTRGGISKAQKGLHLNEDIYAGMN AMIRGGRIKHCEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFL SFYYAHPGFHINNMFIMLSVQMFMIVLINLGALKHETITCRYNPDLPITDPLRPTYCANL TPIVDWVNRCIISIFIVFFISFVPLAVQELTERGVWRMAMRLAKHFGSVSFMFEVFVCQI YANAVHQNLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYAGARSLLMLLFATSTVW TAALIWFWVSLLALCISPFLFNPHQFAWNDFFIDYRDYLRWLSRGNSRSHASSWIGFCRL SRTRITGYKRKLLGVPSEKGSGDVPRARLTNIFFSEIIAPLVLVAVTLVPYLYINSRTGV RDNPETTDAILRLAIVAAGPIAINAGVAGVFFGMACCMGPIFSMCCKKFGAVLAAIAHAI AVIVLLAIFEVMFFLESWSWPRMLIGMIAAAAIQRFIYKLIIALALTREFKHDQSNIAWW TGKWYNMGWHSMSQPGREFLCKITELGYFSADFVLGHVLLFAMLPALCVPFIDKFHSVML FWLRPSRQIRPPIYSLKQSKLRKRRVIRFAILYFGMLILFLVLLIAPLVVRSMGLVKTPN LPFNLLQPLDKDNNDTMVTYTGNNIPAGFEPVESASSVATATS Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Candida krusei infection | [1] | |||
| Resistant Disease | Candida krusei infection [ICD-11: 1F23.4] | |||
| Resistant Drug | Anidulafungin | |||
| Molecule Alteration | Missense mutation | p.F655C |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida krusei strain | 4909 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Broth macrodilution assay | |||
| Mechanism Description | A Candida krusei strain from a patient with acute myelogenous leukemia that displayed reduced susceptibility to echinocandin drugs contained a heterozygous mutation, T2080k, in FkS1. The resulting Phe655-Cys substitution altered the sensitivity of glucan synthase to echinocandin drugs, consistent with a common mechanism for echinocandin resistance in Candida spp. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Candida krusei infection | [2] | |||
| Resistant Disease | Candida krusei infection [ICD-11: 1F23.4] | |||
| Resistant Drug | Caspofungin | |||
| Molecule Alteration | Missense mutation | p.R1361G |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida krusei strain | 4909 | ||
| In Vivo Model | CD-1 murine model of disseminated candidiasis | Mus musculus | ||
| Experiment for Molecule Alteration |
Site-directed mutagenesis; MLST assay | |||
| Experiment for Drug Resistance |
Liquid broth microdilution assay | |||
| Mechanism Description | One group of amino acid substitutions, in the Fks proteins of S. cerevisiae (F639I, V641k, D646Y) and C. albicans (S645F, S645P, S645Y), maps to a short conserved region of ScFks1p and CaFks1p, which lead to caspofungin resistance in the S. cerevisiae and C. albicans as well as C.krusei. | |||
| Disease Class: Candida krusei infection | [1] | |||
| Resistant Disease | Candida krusei infection [ICD-11: 1F23.4] | |||
| Resistant Drug | Caspofungin | |||
| Molecule Alteration | Missense mutation | p.F655C |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida krusei strain | 4909 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Broth macrodilution assay | |||
| Mechanism Description | A Candida krusei strain from a patient with acute myelogenous leukemia that displayed reduced susceptibility to echinocandin drugs contained a heterozygous mutation, T2080k, in FkS1. The resulting Phe655-Cys substitution altered the sensitivity of glucan synthase to echinocandin drugs, consistent with a common mechanism for echinocandin resistance in Candida spp. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Candida krusei infection | [1] | |||
| Resistant Disease | Candida krusei infection [ICD-11: 1F23.4] | |||
| Resistant Drug | Micafungin | |||
| Molecule Alteration | Missense mutation | p.F655C |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida krusei strain | 4909 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Broth macrodilution assay | |||
| Mechanism Description | A Candida krusei strain from a patient with acute myelogenous leukemia that displayed reduced susceptibility to echinocandin drugs contained a heterozygous mutation, T2080k, in FkS1. The resulting Phe655-Cys substitution altered the sensitivity of glucan synthase to echinocandin drugs, consistent with a common mechanism for echinocandin resistance in Candida spp. | |||
| Disease Class: Chronic pulmonary aspergillosis | [3] | |||
| Resistant Disease | Chronic pulmonary aspergillosis [ICD-11: 1F20.5] | |||
| Resistant Drug | Micafungin | |||
| Molecule Alteration | Missense mutation | p.F641S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Aspergillus fumigatus strain | 746128 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Multivariate analysis of overall survival or disease-free survival assay | |||
| Mechanism Description | Emergence of Echinocandin resistance due to a point mutation (F641S ) in the fks1 gene of Aspergillus fumigatus in a patient with chronic pulmonary aspergillosis. | |||
| Disease Class: Chronic pulmonary aspergillosis | [3] | |||
| Resistant Disease | Chronic pulmonary aspergillosis [ICD-11: 1F20.5] | |||
| Resistant Drug | Micafungin | |||
| Molecule Alteration | Missense mutation | p.F675S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Aspergillus fumigatus strain | 746128 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Multivariate analysis of overall survival or disease-free survival assay | |||
| Mechanism Description | Emergence of Echinocandin resistance due to a point mutation (F675S ) in the fks1 gene of Aspergillus fumigatus in a patient with chronic pulmonary aspergillosis. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
