General Information of the Molecule (ID: Mol00878)
Name
Chloramphenicol resistance protein (CMX) ,Corynebacterium glutamicum
Synonyms
cmx; Fragment
    Click to Show/Hide
Molecule Type
Protein
Gene Name
cmx
Sequence
FSLLLITRVLSALANTGFLAVALSTATTLVPANQKGRALSILLSGTTIATVVGVPAGALL
GTALGWRTTFWAIAILCIPAAVGVIRGVTNNVGRSETSATSPRLRVELSQLATPRLILAM
ALGALINGGTFAAFTFLAPIVTETAGLAEAWVSVALVMFGIGSFLGVTIAGRLSDQRPGL
VLAVGGPLLLTGWIVLAV
    Click to Show/Hide
Uniprot ID
A0A345Z5Q8_CORST
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Corynebacteriaceae
Genus: Corynebacterium
Species: Corynebacterium glutamicum
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Chloramphenicol
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Chloramphenicol
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli S17-1 1227813
Corynebacterium glutamicum ATCC 13032 196627
Corynebacterium glutamicum CX61 1718
Corynebacterium glutamicum CX73 1718
Corynebacterium glutamicum RM3 1718
Escherichia coli DH5alphaMCR 668369
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description The central region of Tn5564 encodes the chloramphenicol resistance gene cmx, specifying a transmembrane chloramphenicol efflux protein, and an open reading frame homologous to transposases of insertion sequences identified in Arthrobacter nicotinovorans and Bordetella pertussis.
References
Ref 1 Multifocal outbreaks of metallo-beta-lactamase-producing Pseudomonas aeruginosa resistant to broad-spectrum beta-lactams, including carbapenems. Antimicrob Agents Chemother. 1996 Feb;40(2):349-53. doi: 10.1128/AAC.40.2.349.
Ref 2 Corynebacterium striatum chloramphenicol resistance transposon Tn5564: genetic organization and transposition in Corynebacterium glutamicum. Plasmid. 1998 Sep;40(2):126-39. doi: 10.1006/plas.1998.1362.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.