Molecule Information
General Information of the Molecule (ID: Mol00876)
| Name |
Chloramphenicol acetyltransferase 2 (CATII)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
Chloramphenicol acetyltransferase II; CAT-II
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
cmlA
|
||||
| Sequence |
MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITALRTALAETGYKFYPLMIYLISR
AVNQFPEFRMALKDNELIYWDQSDPVFTVFHKETETFSALSCRYFPDLSEFMAGYNAVTA EYQHDTRLFPQGNLPENHLNISSLPWVSFDGFNLNITGNDDYFAPVFTMAKFQQEGDRVL LPVSVQVHHAVCDGFHAARFINTLQLMCDNILK Click to Show/Hide
|
||||
| Function |
This enzyme is an effector of chloramphenicol resistance in bacteria.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain JM 101 | 562 | ||
| Mechanism Description | Bacterial resistance to the antibiotic chloramphenicol, an inhibitor of the peptidyltransferase activity of prokaryotic ribosomes, is commonly conferred by the enzyme chloramphenicol acetyltransferase (CAT,EC2.3.1.28). The enzyme catalyses transfer of the acetyl group of acetyl-CoA to the primary (C-3) hydroxy group of chloramphenicol, yielding 3-acetylchloramphenicol, which fails to bind to bacterial ribosomes. Three classes of CAT variant have been characterized among Gram-negative bacteria, designated typesI, II and III. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
